Blogg.no Favicon Blogg.no

Blogg.no Website Thumbnail
Checking...
Blogg.no – Norges største bloggportal
Low trust score
Last updated:2020-10-19
Internet and Telecom

Domain summary

Domain label
blogg
Domain extension
no
Global Traffic Rank
30,015
Statvoo Rating
C
Trust Score
Low Trust Score
Estimated worth
$506,880
Estimated daily income
$704
Estimated monthly income
$21,413

Rank summary

How is blogg.no ranked relative to other sites:

Percentage of visits to blogg.no from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Blogg.no registered?
A: Blogg.no was registered 1 month, 4 days, 19 hours, 18 minutes, 59 seconds ago on Monday, October 19, 2020.
Q: When was the WHOIS for Blogg.no last updated?
A: The WHOIS entry was last updated 1 month, 4 days, 19 hours, 18 minutes, 59 seconds ago on Monday, October 19, 2020.
Q: What are Blogg.no's nameservers?
A: DNS for Blogg.no is provided by the following nameservers:
  • betty.ns.cloudflare.com
  • sam.ns.cloudflare.com
Q: Who is the registrar for the Blogg.no domain?
A: The domain has been registered at .
Q: What is the traffic rank for Blogg.no?
A: Blogg.no ranks 30,015 globally on Alexa. Blogg.no has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Blogg.no each day?
A: Blogg.no receives approximately 58,637 visitors and 351,822 page impressions per day.
Q: What IP address does Blogg.no resolve to?
A: Blogg.no resolves to the IPv4 address 104.22.42.95.
Q: In what country are Blogg.no servers located in?
A: Blogg.no has servers located in the United States.
Q: What webserver software does Blogg.no use?
A: Blogg.no is powered by CloudFlare webserver.
Q: Who hosts Blogg.no?
A: Blogg.no is hosted by CloudFlare, Inc. in United States.
Q: How much is Blogg.no worth?
A: Blogg.no has an estimated worth of $506,880. An average daily income of approximately $704, which is roughly $21,413 per month.

Who hosts Blogg.no?

Blogg.no Hosting Provider Information

Hosted IP Address:104.22.42.95
Hosted Hostname:104.22.42.95
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "CloudFlare, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%
CloudFlare, Inc.
1.2102%

HTTP Header Analysis for Blogg.no

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Mon, 19 Oct 2020 01:41:41 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: max-age=3600
Expires: Mon, 19 Oct 2020 02:41:41 GMT
Location: https://blogg.no/
cf-request-id: 05e01e0a5a0000069e6f163000000001
Vary: Accept-Encoding
Server: cloudflare
CF-RAY: 5e46cc56fbd6069e-LHR

Blogg.no Domain Nameserver Information

HostIP AddressCountry
betty.ns.cloudflare.com 173.245.58.75
sam.ns.cloudflare.com 108.162.193.141


Need to find out who hosts Blogg.no?


Domain Registration (WhoIs) information for Blogg.no

 % By looking up information in the domain registration directory
% service, you confirm that you accept the terms and conditions of the
% service:
% https://www.norid.no/en/domeneoppslag/vilkar/
%
% Norid AS holds the copyright to the lookup service, content,
% layout and the underlying collections of information used in the
% service (cf. the Act on Intellectual Property of May 2, 1961, No.
% 2). Any commercial % use of information from the service, including
% targeted marketing, is prohibited. Using information from the domain
% registration directory service in % violation of the terms and
% conditions may result in legal prosecution.
%
% The whois service at port 43 is intended to contribute to resolving
% technical problems where individual domains threaten the
% functionality, security and stability of other domains or the
% internet as an infrastructure. It does not give any information
% about who the holder of a domain is. To find information about a
% domain holder, please visit our website:
% https://www.norid.no/en/domeneoppslag/

Domain Information

NORID Handle...............: BLO2672D-NORID
Domain Name................: blogg.no
Registrar Handle...........: REG42-NORID
Tech-c Handle..............: DH38R-NORID
Name Server Handle.........: BETT4H-NORID
Name Server Handle.........: SAM3H-NORID

Additional information:
Created: 2018-01-03
Last updated: 2019-12-04

Blogg.no Free SEO Report

Website Inpage Analysis for Blogg.no

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

10 :
  1. Topplisten
  2. Topplisten
  3. Topplisten
  4. Topplisten
  5. Topplisten
  6. Topplisten
  7. Topplisten
  8. Topplisten
  9. Topplisten
  10. Topplisten

H4 Headings

1 :
  1. Se bloggernes stories

H5 Headings

14 :
  1. {{:title}}
  2. WINE RED OUTFIT
  3. Søndagskveld
  4. Yatzy og depresjon
  5. Youtube premiere - Denne filmen må du se!
  6. Nordmenn som skammer seg
  7. Powerlady og rockestjernen Hank von Hell - Del 3- Rådgiveren.
  8. Kim Kardashian inspired outfit
  9. Søndagsturen som førte til skjulte skatter...
  10. STOLT AV MÆ SJØL
  11. Har da gjort litt i dag også.
  12. - Har du pissa i sengå, Frode ? ...
  13. Det var ikke sånn jeg mente det
  14. Isbresmeltingen stoppet nesten opp

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

74 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

191:
  1. http://blogg.no/
    http://blogg.no/
  2. Blogg Kategorier
    http://blogg.no/
  3. Blogg Bolig, hytte og interiør
    http://blogg.no/category/bolig-hytte-og-interior
  4. Blogg Byliv
    http://blogg.no/category/byliv
  5. Blogg Dyr
    http://blogg.no/category/dyr
  6. Blogg Familieliv
    http://blogg.no/category/familieliv
  7. Blogg Friluftsliv
    http://blogg.no/category/friluftsliv
  8. Blogg Håndarbeid
    http://blogg.no/category/handarbeid
  9. Blogg Helse og sykdom
    http://blogg.no/category/helse-og-sykdom
  10. Blogg Hobby
    http://blogg.no/category/hobby
  11. Blogg Kultur
    http://blogg.no/category/kultur
  12. Blogg Landliv
    http://blogg.no/category/landliv
  13. Blogg Livsstil
    http://blogg.no/category/livsstil
  14. Blogg Mat
    http://blogg.no/category/mat
  15. Blogg Mote og skjønnhet
    http://blogg.no/category/mote-og-skjonnhet
  16. Blogg Reise
    http://blogg.no/category/reise
  17. Blogg Samfunn
    http://blogg.no/category/samfunn
  18. Blogg Sex og samliv
    http://blogg.no/category/sex-og-samliv
  19. Blogg Sport
    http://blogg.no/category/sport
  20. Blogg Trening
    http://blogg.no/category/trening
  21. Blogg Underholdning
    http://blogg.no/category/underholdning
  22. Blogg VÅRE RETNINGSLINJER
    https://blogg.no/retningslinjer/
  23. Blogg PARTNERPROGRAM
    https://www.blogg.no/partnerprogram
  24. Blogg HJELP
    https://www.blogg.no/faq/
  25. Blogg METAPIC
    https://blogg.no/guide-sann-tjener-du-penger-pa-din-blogg-med-metapic/
  26. Blogg Logg inn
    https://blogg.no/ebp/
  27. Blogg KONTAKT OSS
    http://support.blogg.no/
  28. Blogg {{:blogname}}
    http://blogg.no/{{:blogurl}}
  29. Blogg {{:title}}
    http://blogg.no/{{:link}}
  30. Blogg stina
    http://blogg.no//stina.blogg.no/timeline/
  31. Blogg marenerdvik
    http://blogg.no//marenerdvik.blogg.no/timeline/
  32. Blogg docogdask
    http://blogg.no//docogdask.blogg.no/timeline/
  33. Blogg kjerringtanker
    http://blogg.no//kjerringtanker.blogg.no/timeline/
  34. Blogg smabarnsforeldre
    http://blogg.no//smabarnsforeldre.blogg.no/timeline/
  35. Blogg kokkejaevel
    http://blogg.no//kokkejaevel.blogg.no/timeline/
  36. Blogg mammapaahjul
    http://blogg.no//mammapaahjul.blogg.no/timeline/
  37. Blogg vibbedille
    http://blogg.no//vibbedille.blogg.no/timeline/
  38. Blogg andreaasveinsdottir
    http://blogg.no//andreaasveinsdottir.blogg.no/timeline/
  39. Blogg matfrabunnenfb
    http://blogg.no//matfrabunnenfb.blogg.no/timeline/
  40. Blogg stineskoli
    http://blogg.no//stineskoli.blogg.no/timeline/
  41. Blogg martinehalvs
    http://blogg.no//martinehalvs.blogg.no/timeline/
  42. Blogg sofienils1
    http://blogg.no//sofienils1.blogg.no/timeline/
  43. Blogg metteask
    http://blogg.no//metteask.blogg.no/timeline/
  44. Blogg lavkarbomedhanne
    http://blogg.no//lavkarbomedhanne.blogg.no/timeline/
  45. Blogg ingridaguiluz
    http://blogg.no//ingridaguiluz.blogg.no/timeline/
  46. Blogg konatil
    http://blogg.no//konatil.blogg.no/timeline/
  47. Blogg julianyland
    http://blogg.no//julianyland.blogg.no/timeline/
  48. Blogg sraad
    http://blogg.no//sraad.blogg.no/timeline/
  49. Blogg annarasmussen
    http://blogg.no//annarasmussen.blogg.no/timeline/
  50. Blogg kokkejaevel (140088)
    http://blogg.no//kokkejaevel.blogg.no
  51. Blogg konatil (9466)
    http://blogg.no//konatil.blogg.no
  52. Blogg sraad (8795)
    http://blogg.no//sraad.blogg.no
  53. Blogg sofienils1 (7147)
    http://blogg.no//sofienils1.blogg.no
  54. Blogg metteask (5122)
    http://blogg.no//metteask.blogg.no
  55. Blogg vibbedille (4523)
    http://blogg.no//vibbedille.blogg.no
  56. Blogg stina (4503)
    http://blogg.no//stina.blogg.no
  57. Blogg andreaasveinsdottir (4015)
    http://blogg.no//andreaasveinsdottir.blogg.no
  58. Blogg stineskoli (3927)
    http://blogg.no//stineskoli.blogg.no
  59. Blogg mammapaahjul (3742)
    http://blogg.no//mammapaahjul.blogg.no
  60. Blogg annarasmussen (3496)
    http://blogg.no//annarasmussen.blogg.no
  61. Blogg ingridaguiluz (3286)
    http://blogg.no//ingridaguiluz.blogg.no
  62. Blogg martinehalvs (2576)
    http://blogg.no//martinehalvs.blogg.no
  63. Blogg docogdask (2568)
    http://blogg.no//docogdask.blogg.no
  64. Blogg matfrabunnenfb (2451)
    http://blogg.no//matfrabunnenfb.blogg.no
  65. Blogg lavkarbomedhanne (2120)
    http://blogg.no//lavkarbomedhanne.blogg.no
  66. Blogg marenerdvik (2105)
    http://blogg.no//marenerdvik.blogg.no
  67. Blogg julianyland (1795)
    http://blogg.no//julianyland.blogg.no
  68. Blogg kjerringtanker (1685)
    http://blogg.no//kjerringtanker.blogg.no
  69. Blogg smabarnsforeldre (1623)
    http://blogg.no//smabarnsforeldre.blogg.no
  70. https://beonite.blogg.no/wine-red-outfit.html
    https://beonite.blogg.no/wine-red-outfit.html
  71. Blogg beonite
    http://blogg.no//beonite.blogg.no
  72. Blogg WINE RED OUTFIT
    https://beonite.blogg.no/wine-red-outfit.html
  73. http://damafranord.blogg.no/sondagskveld.html
    http://damafranord.blogg.no/sondagskveld.html
  74. Blogg damafranord
    http://blogg.no//damafranord.blogg.no
  75. Blogg Søndagskveld
    http://damafranord.blogg.no/sondagskveld.html
  76. http://cathrineruth.blogg.no/yatzy-og-depresjon.html
    http://cathrineruth.blogg.no/yatzy-og-depresjon.html
  77. Blogg cathrineruth
    http://blogg.no//cathrineruth.blogg.no
  78. Blogg Yatzy og depresjon
    http://cathrineruth.blogg.no/yatzy-og-depresjon.html
  79. http://miriamhaukebo.blogg.no/youtube-premiere-denne-filmen-ma-du-se.html
    http://miriamhaukebo.blogg.no/youtube-premiere-denne-filmen-ma-du-se.html
  80. Blogg miriamhaukebo
    http://blogg.no//miriamhaukebo.blogg.no
  81. Blogg Youtube premiere - Denne filmen må du se!
    http://miriamhaukebo.blogg.no/youtube-premiere-denne-filmen-ma-du-se.html
  82. http://forbipolene.blogg.no/nordmenn-som-skammer-seg.html
    http://forbipolene.blogg.no/nordmenn-som-skammer-seg.html
  83. Blogg forbipolene
    http://blogg.no//forbipolene.blogg.no
  84. Blogg Nordmenn som skammer seg
    http://forbipolene.blogg.no/nordmenn-som-skammer-seg.html
  85. Blogg annais (1588)
    http://blogg.no//annais.blogg.no
  86. Blogg pilotfrue (1350)
    http://blogg.no//pilotfrue.blogg.no
  87. Blogg spisogspar (1284)
    http://blogg.no//spisogspar.blogg.no
  88. Blogg miniistid (1182)
    http://blogg.no//miniistid.blogg.no
  89. Blogg auroragud (1181)
    http://blogg.no//auroragud.blogg.no
  90. Blogg ninautenfilter (1069)
    http://blogg.no//ninautenfilter.blogg.no
  91. Blogg meglerfru1 (1007)
    http://blogg.no//meglerfru1.blogg.no
  92. Blogg tilbaketillivet (918)
    http://blogg.no//tilbaketillivet.blogg.no
  93. Blogg pappahjerte (861)
    http://blogg.no//pappahjerte.blogg.no
  94. Blogg audmarit (811)
    http://blogg.no//audmarit.blogg.no
  95. Blogg camillaovestad (801)
    http://blogg.no//camillaovestad.blogg.no
  96. Blogg adalsjenta (798)
    http://blogg.no//adalsjenta.blogg.no
  97. Blogg idaamalieunjem (760)
    http://blogg.no//idaamalieunjem.blogg.no
  98. Blogg matholck (755)
    http://blogg.no//matholck.blogg.no
  99. Blogg wenchelarsen (733)
    http://blogg.no//wenchelarsen.blogg.no
  100. Blogg dedication (671)
    http://blogg.no//dedication.blogg.no
  101. Blogg tenaaringspappa (667)
    http://blogg.no//tenaaringspappa.blogg.no
  102. Blogg isabelleeriksen (663)
    http://blogg.no//isabelleeriksen.blogg.no
  103. Blogg idarossland (637)
    http://blogg.no//idarossland.blogg.no
  104. Blogg lailasmat (628)
    http://blogg.no//lailasmat.blogg.no
  105. http://powerlady.blogg.no/powerlady-og-rockestjernen-hank-von-hell-del-3-radgiveren.html
    http://powerlady.blogg.no/powerlady-og-rockestjernen-hank-von-hell-del-3-radgiveren.html
  106. Blogg powerlady
    http://blogg.no//powerlady.blogg.no
  107. Blogg Powerlady og rockestjernen Hank von Hell - Del 3- Rådgiveren.
    http://powerlady.blogg.no/powerlady-og-rockestjernen-hank-von-hell-del-3-radgiveren.html
  108. https://stina.blogg.no/kim-kardashian-inspired-outfit.html
    https://stina.blogg.no/kim-kardashian-inspired-outfit.html
  109. Blogg stina
    http://blogg.no//stina.blogg.no
  110. Blogg Kim Kardashian inspired outfit
    https://stina.blogg.no/kim-kardashian-inspired-outfit.html
  111. http://tenaaringspappa.blogg.no/sondagsturen-som-forte-til-skjulte-skatter.html
    http://tenaaringspappa.blogg.no/sondagsturen-som-forte-til-skjulte-skatter.html
  112. Blogg tenaaringspappa
    http://blogg.no//tenaaringspappa.blogg.no
  113. Blogg Søndagsturen som førte til skjulte skatter...
    http://tenaaringspappa.blogg.no/sondagsturen-som-forte-til-skjulte-skatter.html
  114. http://zoeticworld.blogg.no/stolt-av-mae-sjol.html
    http://zoeticworld.blogg.no/stolt-av-mae-sjol.html
  115. Blogg zoeticworld
    http://blogg.no//zoeticworld.blogg.no
  116. Blogg STOLT AV MÆ SJØL
    http://zoeticworld.blogg.no/stolt-av-mae-sjol.html
  117. Blogg leneorvik (574)
    http://blogg.no//leneorvik.blogg.no
  118. Blogg jessicaenerberg (567)
    http://blogg.no//jessicaenerberg.blogg.no
  119. Blogg psykopati (558)
    http://blogg.no//psykopati.blogg.no
  120. Blogg fikside (527)
    http://blogg.no//fikside.blogg.no
  121. Blogg lassel (518)
    http://blogg.no//lassel.blogg.no
  122. Blogg bokebloggen (489)
    http://blogg.no//bokebloggen.blogg.no
  123. Blogg supporterfrue (448)
    http://blogg.no//supporterfrue.blogg.no
  124. Blogg ninasprelllevende (407)
    http://blogg.no//ninasprelllevende.blogg.no
  125. Blogg annmariolsen (388)
    http://blogg.no//annmariolsen.blogg.no
  126. Blogg jeggikkbareibodenentur (386)
    http://blogg.no//jeggikkbareibodenentur.blogg.no
  127. Blogg heidirosander (374)
    http://blogg.no//heidirosander.blogg.no
  128. Blogg queendthatsme (373)
    http://blogg.no//queendthatsme.blogg.no
  129. Blogg eliseamanda (347)
    http://blogg.no//eliseamanda.blogg.no
  130. Blogg tallatroll (327)
    http://blogg.no//tallatroll.blogg.no
  131. Blogg solliv (311)
    http://blogg.no//solliv.blogg.no
  132. Blogg nesfotballen (297)
    http://blogg.no//nesfotballen.blogg.no
  133. Blogg mammantilenautist (285)
    http://blogg.no//mammantilenautist.blogg.no
  134. Blogg hobbyokonomen (284)
    http://blogg.no//hobbyokonomen.blogg.no
  135. Blogg andreabadendyck (278)
    http://blogg.no//andreabadendyck.blogg.no
  136. Blogg jannenordvang (272)
    http://blogg.no//jannenordvang.blogg.no
  137. Blogg nasjonalgastro (261)
    http://blogg.no//nasjonalgastro.blogg.no
  138. Blogg elisabethuglebakken (259)
    http://blogg.no//elisabethuglebakken.blogg.no
  139. Blogg miba (247)
    http://blogg.no//miba.blogg.no
  140. Blogg lillasjel (242)
    http://blogg.no//lillasjel.blogg.no
  141. Blogg iselinguttormsen (240)
    http://blogg.no//iselinguttormsen.blogg.no
  142. Blogg saraaemiliee (236)
    http://blogg.no//saraaemiliee.blogg.no
  143. Blogg terjeaa (235)
    http://blogg.no//terjeaa.blogg.no
  144. Blogg vabofamily (235)
    http://blogg.no//vabofamily.blogg.no
  145. Blogg hannehome (235)
    http://blogg.no//hannehome.blogg.no
  146. Blogg aperitivomat (235)
    http://blogg.no//aperitivomat.blogg.no
  147. https://audmarit.blogg.no/har-da-gjort-litt-i-dag-ogsa.html
    https://audmarit.blogg.no/har-da-gjort-litt-i-dag-ogsa.html
  148. Blogg audmarit
    http://blogg.no//audmarit.blogg.no
  149. Blogg Har da gjort litt i dag også.
    https://audmarit.blogg.no/har-da-gjort-litt-i-dag-ogsa.html
  150. http://jeggikkbareibodenentur.blogg.no/har-du-pissa-i-senga-frode.html
    http://jeggikkbareibodenentur.blogg.no/har-du-pissa-i-senga-frode.html
  151. Blogg jeggikkbareibodenentur
    http://blogg.no//jeggikkbareibodenentur.blogg.no
  152. Blogg - Har du pissa i sengå, Frode ? ...
    http://jeggikkbareibodenentur.blogg.no/har-du-pissa-i-senga-frode.html
  153. Blogg evaswindow (230)
    http://blogg.no//evaswindow.blogg.no
  154. Blogg benteslilleverden (229)
    http://blogg.no//benteslilleverden.blogg.no
  155. Blogg outdoorkids (227)
    http://blogg.no//outdoorkids.blogg.no
  156. Blogg siljebjornstad (219)
    http://blogg.no//siljebjornstad.blogg.no
  157. Blogg elineredderverdenlitt (217)
    http://blogg.no//elineredderverdenlitt.blogg.no
  158. Blogg mallemey (211)
    http://blogg.no//mallemey.blogg.no
  159. Blogg frodith (209)
    http://blogg.no//frodith.blogg.no
  160. Blogg forswingende (207)
    http://blogg.no//forswingende.blogg.no
  161. Blogg cathrineruth (207)
    http://blogg.no//cathrineruth.blogg.no
  162. Blogg stavangerinmyheart (205)
    http://blogg.no//stavangerinmyheart.blogg.no
  163. http://leneetarnes.blogg.no/det-var-ikke-sann-jeg-mente-det.html
    http://leneetarnes.blogg.no/det-var-ikke-sann-jeg-mente-det.html
  164. Blogg leneetarnes
    http://blogg.no//leneetarnes.blogg.no
  165. Blogg Det var ikke sånn jeg mente det
    http://leneetarnes.blogg.no/det-var-ikke-sann-jeg-mente-det.html
  166. https://hovedsteder.blogg.no/isbresmeltingen-stoppet-nesten-opp.html
    https://hovedsteder.blogg.no/isbresmeltingen-stoppet-nesten-opp.html
  167. Blogg hovedsteder
    http://blogg.no//hovedsteder.blogg.no
  168. Blogg Isbresmeltingen stoppet nesten opp
    https://hovedsteder.blogg.no/isbresmeltingen-stoppet-nesten-opp.html
  169. Blogg damafranord (202)
    http://blogg.no//damafranord.blogg.no
  170. Blogg benedictehaugaard (200)
    http://blogg.no//benedictehaugaard.blogg.no
  171. Blogg mettejosteinsdatter (198)
    http://blogg.no//mettejosteinsdatter.blogg.no
  172. Blogg fruensvilje (195)
    http://blogg.no//fruensvilje.blogg.no
  173. Blogg bunnytrash (193)
    http://blogg.no//bunnytrash.blogg.no
  174. Blogg geriatriks (191)
    http://blogg.no//geriatriks.blogg.no
  175. Blogg kvitlyngveien (188)
    http://blogg.no//kvitlyngveien.blogg.no
  176. Blogg hovedsteder (187)
    http://blogg.no//hovedsteder.blogg.no
  177. Blogg konghalvor (185)
    http://blogg.no//konghalvor.blogg.no
  178. Blogg utifriluft (182)
    http://blogg.no//utifriluft.blogg.no
  179. Blogg dedicat (173)
    http://blogg.no//dedicat.blogg.no
  180. Blogg lenalykke (172)
    http://blogg.no//lenalykke.blogg.no
  181. Blogg martejohannessen (169)
    http://blogg.no//martejohannessen.blogg.no
  182. Blogg kariannenesse (162)
    http://blogg.no//kariannenesse.blogg.no
  183. Blogg fantastiskturglede (156)
    http://blogg.no//fantastiskturglede.blogg.no
  184. Blogg frkfrontend (153)
    http://blogg.no//frkfrontend.blogg.no
  185. Blogg turogtrening (152)
    http://blogg.no//turogtrening.blogg.no
  186. Blogg kokkengeir (151)
    http://blogg.no//kokkengeir.blogg.no
  187. Blogg fullstendigkaos (151)
    http://blogg.no//fullstendigkaos.blogg.no
  188. Blogg norgeogverdensnytt (142)
    http://blogg.no//norgeogverdensnytt.blogg.no
  189. Blogg VÅRE RETNINGSLINJER
    https://www.blogg.no/retningslinjer
  190. Blogg VILKÅR
    https://www.blogg.no/vilkar/
  191. Blogg www.blogg.no
    https://www.blogg.no

Links - Internal (nofollow)

0:

Keyword Cloud for Blogg.no

topplisten viserog skjnnhetreiseforcetopplistenanalytics se mersamfunn sexhobby kultursidevisningerhytte ogog interirkilde google analyticsviseroggoogleinterir bylivformantall sidevisninger sistelivsstil matsamliv sportkultur landlivkilde googletruesidevisninger siste dgntotalewpdpdateformatbolig hyttebolig hytte ogsidevisninger sistedateformatse mer avdgn kilde googletrening underholdningcf7submitelm typeof jqueryboligtotale antall sidevisningerdet totale antalldatepickerundefinedviser dettypeofhndarbeid helsesiste dgndyrlivsstil mat motesykdom hobby kulturog interir bylivlivsstilskjnnhetdethelse og sykdomsamlivdgnav topplisten topplistenmer avmeranalytics sehobbybyliv dyr familielivfamilieliv friluftsliv hndarbeidsamfunn sex oghobby kultur landlivkultur landliv livsstilinterirsport trening underholdninglandliv livsstil matddmmyyifnull cf7submitelmsexmote ogmat motebloggenhndarbeiddyr familielivjquerysykdomforce iftypeofsamfunnav topplistenog sykdom hobbyavmfriluftsliv hndarbeidlandliv livsstilhytte og interirog skjnnhet reisemat mote ogmote og skjnnhetmotefriluftsliv hndarbeid helsetopplisten viser detifunderholdningforce iftypeof datepickerundefinedog sykdomdgn kildelandlivkulturanalyticsholdertopplisten topplistendyr familieliv friluftslivtotale antallantallsomog samliv sporthelsetypeof jqueryfamilieliv friluftslivhyttevarwpdprefreshfirstsykdom hobbyfriluftslivsiste dgn kildeifnull cf7submitelm typeofcf7submitelm typeofkokkejaevelsport treningiftypeofinterir byliv dyrtreningreise samfunnviser det totaledet totalesportskjnnhet reisesistesex og samlivse mersex ogskjnnhet reise samfunnbylivcf7submitelmreise samfunn sex0google analyticshndarbeid helse ogbyliv dyrmatsegoogle analytics sekildehelse ogog samlivsamliv sport treningfunctionantall sidevisningerthisvalmer av topplistenifnullfamilieliviftypeof datepickerundefined

Longtail Keyword Density for Blogg.no

KeywordsOccurences
siste dgn kilde10
det totale antall10
topplisten viser det10
viser det totale10
kilde google analytics10
dgn kilde google10
sidevisninger siste dgn10
antall sidevisninger siste10
totale antall sidevisninger10
mer av topplisten8
se mer av8
analytics se mer8
google analytics se8
mote og skjnnhet4
mat mote og4
cf7submitelm typeof jquery4
ifnull cf7submitelm typeof4
og samliv sport3
av topplisten topplisten3
force iftypeof datepickerundefined3
sport trening underholdning3
samliv sport trening3
bolig hytte og3
sex og samliv3
helse og sykdom3
og interir byliv3
interir byliv dyr3
byliv dyr familieliv3
dyr familieliv friluftsliv3
familieliv friluftsliv hndarbeid3
friluftsliv hndarbeid helse3
hndarbeid helse og3
og sykdom hobby3
hytte og interir3
sykdom hobby kultur3
hobby kultur landliv3
kultur landliv livsstil3
landliv livsstil mat3
livsstil mat mote3
og skjnnhet reise3
skjnnhet reise samfunn3
reise samfunn sex3
samfunn sex og3
topplisten viser10
google analytics10
viser det10
det totale10
totale antall10
antall sidevisninger10
sidevisninger siste10
siste dgn10
dgn kilde10
kilde google10
analytics se8
se mer8
mer av8
av topplisten8
mat mote4
mote og4
og skjnnhet4
ifnull cf7submitelm4
cf7submitelm typeof4
typeof jquery4
trening underholdning3
topplisten topplisten3
force iftypeof3
iftypeof datepickerundefined3
bolig hytte3
sport trening3
og sykdom3
og interir3
interir byliv3
byliv dyr3
dyr familieliv3
familieliv friluftsliv3
friluftsliv hndarbeid3
hndarbeid helse3
helse og3
sykdom hobby3
samliv sport3
hobby kultur3
kultur landliv3
landliv livsstil3
livsstil mat3
skjnnhet reise3
reise samfunn3
samfunn sex3
sex og3
hytte og3
og samliv3
topplisten28
var19
og16
det12
av12
antall10
se10
totale10
sidevisninger10
siste10
dgn10
kilde10
google10
analytics10
viser10
function10
mer9
cf7submitelm6
force5
typeof5
if4
thisval4
dateformat4
form4
holder4
ifnull4
bloggen4
jquery4
underholdning4
familieliv4
mat4
mote4
skjnnhet4
dyr3
friluftsliv3
hndarbeid3
helse3
wpdpdateformat3
byliv3
interir3
sykdom3
datepickerundefined3
iftypeof3
hobby3
ddmmyy3
kokkejaevel3
true3
03
wpdprefreshfirst3
kultur3
landliv3
livsstil3
som3
m3
reise3
samfunn3
sex3
samliv3
sport3
hytte3
trening3
bolig3

Blogg.no Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Blogg-borgestadklinikken.com
Om rus og avhengighet | Blogg fra Blå Kors Borgestadklinikken og KoRus Sør
Blogg-buzz.com
Shemale live escort, happy ending massage - Blogg Buzz
Blogg-cafe.com
Blogg café – Le blog de vos sorties !
Blogg-design.com
粉色成年视频入口|粉色无限诱惑 大片|粉色在线电影
Blogg-livetsgoda.se
Prenumerera på Vin
Blogg.asia
Object not found!
Blogg.com
blogg.com * (((globalism))) will always fail
Blogg.de
Blog • Neuigkeiten & spannende Themen auf Blogg.de
Blogg.fi
Site not found
Blogg.no
Blogg.no – Norges største bloggportal

Recently Updated Websites

Chestertownbrokers.com 2 seconds ago.Aklotma.com 2 seconds ago.Vodoroy.ru 4 seconds ago.Tobias-riefer.de 4 seconds ago.Eprosfora.gr 4 seconds ago.Johannadaher.com 5 seconds ago.Tc-prospekt.ru 5 seconds ago.Massarcloud.sa 6 seconds ago.Petdesignz.com 6 seconds ago.Selige.org 6 seconds ago.Jpwoodsinc.com 7 seconds ago.Elserhealthtourism.com 8 seconds ago.Pornoarena.biz 9 seconds ago.Agabaraniak.com 10 seconds ago.Nicolemgoodreau.com 10 seconds ago.Varna-tour.com 11 seconds ago.Tvoy-proizv.com 11 seconds ago.Lescoladelmon.com 11 seconds ago.Anappleaday.com 12 seconds ago.Infoimpulses.com 13 seconds ago.Nickmodrzejewski.com 13 seconds ago.Gilsoncoelho.com.br 14 seconds ago.Overdrone.co.uk 14 seconds ago.Cghomeinteriors.com 15 seconds ago.Firelineneon.com 15 seconds ago.Romex-ag.com 15 seconds ago.Knivberga.se 15 seconds ago.Karinereeve.com 17 seconds ago.Songga.com 17 seconds ago.Gradient-a.ru 17 seconds ago.