Summary  |  BMI Rechner - Body Mass Index - BMI online berechnen
Low trust score  | 
BMI Rechner kostenlos: Hier können Sie kostenlos, schnell und unkompliziert Ihren BMI berechnen (Body Mass Index) inkl. BMI Test, BMI Formel und BMI Tabelle. Ausserdem finden Sie weitere Informationen zum Thema Kalorien und Diät. has a Low Trust Score, and a Statvoo Rank of F. is hosted by STRATO AG in Berlin, Berlin, Germany, 10178. has an IP Address of and a hostname of

The domain was registered 1 decade 2 years 10 months ago by , it was last modified 4 years 10 months 3 days ago and currently is set to expire 3 years 10 months 1 hour ago.

Whois information for

Full Whois Lookup for Whois Lookup

Registry Domain ID: 872581044_DOMAIN_NET-VRSN
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2017-03-12T12:31:51Z
Creation Date: 2007-03-13T17:25:19Z
Registry Expiry Date: 2018-03-13T17:25:19Z
Registrar: Mesh Digital Limited
Registrar IANA ID: 1390
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of whois database: 2017-08-27T16:12:53Z

Who hosts Web Server Information

Hosted IP Address:
Service Provider:STRATO AG
Hosted Country:GermanyDE
Location Latitude:52.5244
Location Longitude:13.4105
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Tue, 07 Jul 2015 00:35:23 GMT
Content-Type: text/html
Content-Length: 17728
Connection: keep-alive
X-Accel-Version: 0.01
Accept-Ranges: bytes
Vary: Accept-Encoding
Content-Encoding: gzip
X-Powered-By: PleskLin
MS-Author-Via: DAV

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:1
H2 Headings:1
H3 Headings:1
H4 Headings:1
H5 Headings:1
H6 Headings:1
Total IFRAMEs:0
Total Images:7
Google Adsense:pub-6767814208406390
Google Analytics:UA-634217-32

Keyword Cloud for

geschlechtamputationistganzenadipositasvorhercommentswenn siekeineder bmigeben siedashomepagedurch1ganzeberechnenkrpergredenkilogrammwerdenweiterebmi bodybody mass indexlowberechnungmanncarbgebenmuskelmassemitfeeinkinderoderbeimass indexumknnenbmi rechner fralterbmi formelzuuntergemsesindkrperihrervielframputationenfinden sienichtfindenrapslbeimfunctionzweiauchallecurtopgrundumsatzpushadsbygoogle windowadsbygoogleabnehmenbmi rechner bmidannerhaltennormalgewichtbmirechnerbzweineeinenwindowadsbygoogle pushkrpergewichtwenndesartikelsie dannsolltenden bmigewichtsahneimihrewirdrechner bmi rechnerlow carbalsrechner frzumwindowadsbygooglevieleidealgewichtjahrenbereich19240sichum denknnen siefalljedochsie sichadsbygoogle windowadsbygoogle pushditenaufsie ihrderkalorienhandbeidemasshabenweiterenthltbittewertwirdas gewichtessenbmi rechnernbspfragenloaddisqusbitte gebenwindowadsbygoogle push bmitabellenzeiteinerbody massarztzwischenbmi body massauf denzwischendurchpush bminachdemobstvarerwachsenevoneinserviceunbedingtbitte geben sierechner idealgewichtadsbygooglethemanureszuckerwieihnensie diekalorienrechnerihrendassditbergewichtkaltgepresstes rapsl2zum bmiunterschenkelsieindexdiefrautabellefetteinemrechner bmikeinkaltgepressteshiertrinkenihrfr dietestkalorientabellebmi testzursie bitteformelsie vorherbodygreanderesehr

Longtail Keyword Density for

body mass index10
bmi rechner fr5
adsbygoogle windowadsbygoogle push4
bmi rechner bmi4
windowadsbygoogle push bmi3
bitte geben sie3
bmi body mass3
rechner bmi rechner3
bmi rechner20
low carb11
mass index10
body mass10
geben sie7
sie bitte6
der bmi6
rechner fr6
sie sich5
rechner bmi5
das gewicht4
finden sie4
adsbygoogle windowadsbygoogle4
windowadsbygoogle push4
bmi test4
um den4
sie ihr3
auf den3
sie die3
wenn sie3
sie vorher3
kaltgepresstes rapsl3
sie dann3
fr die3
den bmi3
zum bmi3
push bmi3
bmi body3
bmi formel3
knnen sie3
rechner idealgewicht3
bitte geben3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Germany Germany Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?