Bodyandmind.co.za  |  Body and Mind
Low trust score  | 
Body and Mind promotes people who offer a variety of complementary therapies and products from aromatherapy to Zen Meditation. Our aim is to help people to maintain a complete state of wellness through the integration of health, lifestyle and beauty. On this site you will find a countrywide directory of complementary health professionals and an ...




Bodyandmind.co.za Website Information

Website Ranks & Scores for Bodyandmind.co.za

Statvoo Rank Statvoo Rank:G
Alexa Rank Alexa Rank:494,326
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:32%
DMOZ DMOZ Listing:No

Domain Information for Bodyandmind.co.za

Domain Registrar: UniForum Association
Last Modified:2011-05-04  8 years 1 month 2 weeks ago
Owner's E-Mail:Login to show email

Whois information for bodyandmind.co.za

Full Whois Lookup for Bodyandmind.co.za Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Bodyandmind.co.za. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

simple CO.ZA whois server
The CO.ZA simple whois server
© Copyright ZACR 1995-2017
Use of this facility subject to theterms of site usage
Your query has generated the following reply:-

Search on bodyandmind (.co.za)
Match: One

Domain: bodyandmind.co.za

Accounting info....
Date |Type| Cost |Invoices are E-Mail to....|Paid Date |ICnt| TrkNo |Billing Info

Flashing RED indicates that payment has not been received - please
confirm with the ZACR accounting department, Login to show email
should this
not be according to your records. You have been sent 0 invoices/statements.

0a. lastupdate :
0b. emailsource :
0c. emailposted :
0d. emailsubject :
0g. historycount :
0h. invoiceno :
0i. contracttype :
0j. rcsversion :
1a. domain : bodyandmind.co.za
1b. action :
1c. Registrar : Domains
2a. registrant : Traci French
2b. registrantpostaladdress: 20 Lesley Drive, Hattons, , Pinetown, KwaZulu-Natal, 3610, ZA
2c. registrantstreetaddress:
2d. amount :
2e. paymenttype :
2f. billingaccount :
2g. billingemail :
2i. invoiceaddress :
2j. registrantphone : +27.317017548
2k. registrantfax :
2l. registrantemail : Login to show email
vat :
3b. cname :
3c. cnamesub1 :
3d. cnamesub2 :
3e. creationdate : 2000/08/28 10:01:39
4a. admin :
4b. admintitle :
4c. admincompany :
4d. adminpostaladdr :
4e. adminphone :
4f. adminfax :
4g. adminemail :
4h. adminnic :
5a. tec :
5b. tectitle :
5c. teccompany :
5d. tecpostaladdr :
5e. tecphone :
5f. tecfax :
5g. tecemail :
5h. tecnic :
6a. primnsfqdn : ns1.pipedns.com
6b. primnsip :
6c. primnsipv6 :
6e. secns1fqdn : ns2.pipedns.com
6f. secns1ip :
6g. secns1ipv6 :
6i. secns2fqdn : ns3.pipedns.com
6j. secns2ip :
6k. secns2ipv6 :
6m. secns3fqdn :
6n. secns3ip :
6o. secns3ipv6 :
6q. secns4fqdn :
6r. secns4ip :
6s. secns4ipv6 :
8a. netblock1start :
8b. netblock1end :
8c. netblock2start :
8d. netblock2end :
8e. netblock3start :
8f. netblock3end :
9a. description1 :
9b. description2 :
9c. description3 :
9d. description4 :
9e. description5 :
9f. description6 :

Next Query - Domain name
.co.za
Please refer to the CO.ZA contact details should you have any problems

Who hosts Bodyandmind.co.za?

Bodyandmind.co.za is hosted by Unified Layer in Utah, Provo, United States, 84606.
Bodyandmind.co.za has an IP Address of 173.254.28.64 and a hostname of just64.justhost.com.



Bodyandmind.co.za Web Server Information

Hosted IP Address:173.254.28.64
Hosted Hostname:just64.justhost.com
Service Provider:Unified Layer
Hosted Country:United StatesUS
Location Latitude:40.2181
Location Longitude:-111.6133
Webserver Software:Not Applicable

HTTP Header Analysis for Bodyandmind.co.za

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Mon, 29 Jun 2015 06:56:59 GMT
Server: Apache
Last-Modified: Thu, 25 Jun 2015 09:22:56 GMT
Accept-Ranges: bytes
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 26116
Content-Type: text/html


Need to find out who hosts Bodyandmind.co.za?

Bodyandmind.co.za Free SEO Report

Website Inpage Analysis for Bodyandmind.co.za

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Bodyandmind.co.za

teamesoteric082beingeventsalchemyfarmacynatural healingnew fnwpsliderrelatedhavegnanimationtime500fnwpslidergstreasing swinggstreasingamp083swing varherba farmacynaturalmyusprofessionalshealth and wellsoreadproductsalchemy esotericwell beingswinggstreasing swing varlifetheyshoppe and wellnesshealthbody and mindshoppenewourallmobileherba farmacynatural healingmobile 082therapistsyournaturalesoteric shoppenbsponlinehealingwellness centreshopherbatheircrystalmorewellnessmindcentrevarfarmacynaturalalchemy esoteric shopperead morewebpagebodywellyougbplayatstarttruegnanimationtime500 gbplayatstarttruefreealternative

Longtail Keyword Density for Bodyandmind.co.za

KeywordsOccurences
body and mind5
gstreasing swing var3
health and well3
alchemy esoteric shoppe3
herba farmacy-natural healing3
shoppe and wellness3
read more15
mobile 0828
new fnwpslider4
gnanimationtime500 gbplayatstarttrue4
gstreasing swing4
well being4
farmacy-natural healing3
swing var3
alchemy esoteric3
esoteric shoppe3
wellness centre3
herba farmacy-natural3
more16
mobile15
read15
amp12
body10
health9
your9
0828
healing8
mind7
var7
us7
all7
you6
wellness5
alternative5
they5
online4
being4
well4
natural4
products4
my4
new4
fnwpslider4
gnanimationtime5004
webpage4
have4
swing4
gstreasing4
our4
gbplayatstarttrue4
free3
crystal3
0833
esoteric3
herba3
farmacy-natural3
so3
team3
professionals3
nbsp3
related3
their3
centre3
life3
shoppe3
alchemy3
events3
shop3
therapists3

What are the nameservers for bodyandmind.co.za?

Bodyandmind.co.za Domain Nameserver Information

HostIP AddressCountry
ns1.pipedns.com 162.159.24.49United States United States
ns2.pipedns.com 162.159.25.241United States United States
ns3.pipedns.com 162.159.25.241United States United States

Bodyandmind.co.za Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Bodyandmind.co.za is a scam?