Ladies Fashions from Bonmarché : Plus Size Women?s Clothing and Accessories

Safety: Low trust score
Year Founded: 1998
Global Traffic Rank: 135,516
Estimated Worth: $180,720
Category: Shopping > Clothing

Shop online now for Womens Clothing in sizes 10-32 from the UK's largest value retailer for ladies plus size clothes with exclusive designer styles from David Emanuel.



Domain summary

Last updated
2015-06-19
Domain label
bonmarche
Domain extension
co.uk
Domain registered:
1998-06-25
Domain updated:
2014-12-16
Domain expires:
0000-00-00
Global Traffic Rank
135,516
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$180,720
Estimated daily income
$251
Estimated monthly income
$7,635

Frequently Asked Questions (FAQ)

Q: When was Bonmarche.co.uk registered?
A: Bonmarche.co.uk was registered 23 years, 1 month, 1 week, 1 day, 6 hours, 50 minutes, 40 seconds ago on Thursday, June 25, 1998.
Q: When was the WHOIS for Bonmarche.co.uk last updated?
A: The WHOIS entry was last updated 6 years, 7 months, 2 weeks, 4 days, 6 hours, 50 minutes, 40 seconds ago on Tuesday, December 16, 2014.
Q: What are Bonmarche.co.uk's nameservers?
A: DNS for Bonmarche.co.uk is provided by the following nameservers:
  • ans1.cw.net
Q: Who is the registrar for the Bonmarche.co.uk domain?
A: The domain has been registered at .
Q: What is the traffic rank for Bonmarche.co.uk?
A: Bonmarche.co.uk ranks 135,516 globally on Alexa. Bonmarche.co.uk has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Bonmarche.co.uk each day?
A: Bonmarche.co.uk receives approximately 20,903 visitors and 125,418 page impressions per day.
Q: What IP address does Bonmarche.co.uk resolve to?
A: Bonmarche.co.uk resolves to the IPv4 address 212.25.233.88.
Q: In what country are Bonmarche.co.uk servers located in?
A: Bonmarche.co.uk has servers located in the United Kingdom.
Q: What webserver software does Bonmarche.co.uk use?
A: Bonmarche.co.uk is powered by webserver.
Q: Who hosts Bonmarche.co.uk?
A: Bonmarche.co.uk is hosted by Venda Limited in England, London, United Kingdom, Wc2n 4a.
Q: How much is Bonmarche.co.uk worth?
A: Bonmarche.co.uk has an estimated worth of $180,720. An average daily income of approximately $251, which is roughly $7,635 per month.

Bonmarche.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Bonmarche.co.uk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Bonmarche.co.uk

H1 Headings

1 :
  1. 0

H2 Headings

1 :
  1. 1

H3 Headings

1 :
  1. 0

H4 Headings

1 :
  1. 0

H5 Headings

1 :
  1. 2

H6 Headings

1 :
  1. 3

Total IFRAMEs

0 :

Total Images

25 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-2298430-6

Links - Internal

1:

Links - Internal (nofollow)

1:

Links - Outbound

1:

Links - Outbound (nofollow)

1:

Keyword Cloud for Bonmarche.co.uk

fontweightshortsiftypeof adalyserdatalayerease 0s bordercolornowtransitioncolor 025sjeansbackgroundrepeat norepeat backgroundsizebottomtransitioncolorcatalogue requestamp shortsmargin 01forvar i 0blouses amptriggermailwidthdatenow1000606024togmtstring pathcurrentlywearbackgroundpositionknitwear lingeriejackets dressestextjavascript0 sessionstarthttps documentlocationprotocolfree collectmy accountbonmarchrainsleevesswim amptshirtsnorepeat backgroundsizeiftypeof adalyserdatalayer undefineddresses jeans knitwearbackgroundcolor0else ifbordercolordisplayinlineblockamp jackets dressesharveysalefabricyoulandingpagereferrervaluemostiftypeofbordercolor 025sshirts coatsinformationmybrowserfootwearremainingnew season lookbooktrousers amp shorts0 0collect instoreenter a valuebackgroundrepeatfree delivery overlandingpage documentlocationhrefsummer tops summertruetimedbanner colored transitioncolorinspire0 landingpagetrouserscanheyesshineheight 22pxamp footwearitemsdresses jeanstrousers ampbackgroundcolor 025sinstoredisplaybackgroundsizebeachwearcataloguedressescollecthttpsfreeamp tunicsifmarkaccessories ampcontent23pxeurcoats amp0 lastvisitsummerdatelearnamp tunics trousersgbpjackets dresses jeanstunicsinspire meyourdeliveryamp jacketsfashion markorderfree collect instorenew datenow1000606024togmtstring pathdelivery over 35var22pxtops amp tunicscookiesbonusthanopacitycertificatefirstvisittimedbannerlandingpagereferrer documentreferrerbackgroundposition leftjacketsfabric in fashionelseswimholidayflatteringautodatenow1000606024togmtstring path documentcookieanncoats come rainfunctionswim amp beachwearstoregiftnew seasonmarginlookbooktunics trousers ampblousesfontsizeblouses amp shirts4findnorepeatstatementann harveystatement sleeves0s opacity 025sdocumentgetelementsbytagnamescript0centerchangepath0s backgroundcolor0s bordercolor 025s025s easepath documentcookiesearch3creditlandingpagedocumentcreateelementscript025stops ampforvarovernew datenow1000606024togmtstringverticalalign middlecurrently notstylish coatsaccountexpires new datenow1000606024togmtstringhavegift certificate0s bordercolorease 0sfashion mark heyestshirts topsavailabledelivery over0s backgroundcolor 025sinlineblockcardcolor000000important transitioncolorofferscoats amp jacketscolor000000important transitioncolor 025s0 widthentersummer topsup10 else ifopacity 025stop2amp nightwearusdease 0s opacitytshirts tops ampfunction varwear statementtransitioncolor 025s easeremaining itemsseasonaccessories amp footwearamp shirts coatsrequestrain or shinelineheightwomensnormalcolored color000000important025s ease 0sshirts coats ampcolored color000000important transitioncolornewbackgroundcolor 025s easedocumentcookienightwearlastvisit10 elsecoatsease 0s backgroundcolorstylish coats comeallenter a validseason lookbook freesizessessionstartmiddlerightcoloredcome rainamp beachwearmeshopdocumentlocationprotocolmost flattering fabricskirtsbonus clubflattering fabrictunics trouserslingerie ampbackgroundposition rightpleasestylishcolor000000importantadalyserdatalayer undefinedregistervalidcolored transitioncolor 025sfind a storecardstops summerbordercolor 025s easeitemdocumentlocationhreftopsadalyserdatalayerleftseason lookbooklingerie amp nightwearwomens clothingdisplay inlineblockamp shirtsopacity 025s easeampnotcolored transitioncolorexpires newisnewsessionitems are availablesitelookbook freewear statement sleevesgift cardsbackgroundposition centerclothingaccessoriescurlfashion0sswimwearbackgroundrepeat norepeatmoremost flatteringfree delivery0s opacitytimedbanner coloredundefinedexpiresusimportantheightlearn morecoats comeover 35easeverticalaligncomedocumentreferrerdatenow1000606024togmtstringknitwearjeans knitwearreturnmark heyesshirtslingeriedorinaclubsrcsign

Longtail Keyword Density for Bonmarche.co.uk

KeywordsOccurences
025s ease 0s24
enter a valid9
0s border-color 025s6
border-color 025s ease6
ease 0s border-color6
0s opacity 025s6
ease 0s opacity6
0s background-color 025s6
transitioncolor 025s ease6
ease 0s background-color6
swim amp beachwear6
background-color 025s ease6
opacity 025s ease6
t-shirts tops amp6
blouses amp shirts6
amp jackets dresses6
amp shirts coats6
tops amp tunics6
shirts coats amp6
amp tunics trousers6
coats amp jackets6
fashion mark heyes5
free collect in-store5
season lookbook free4
free delivery over4
delivery over 354
expires new datenow1000606024togmtstring4
enter a value4
dresses jeans knitwear4
trousers amp shorts4
new datenow1000606024togmtstring path4
new season lookbook4
accessories amp footwear4
lingerie amp nightwear4
jackets dresses jeans4
tunics trousers amp4
datenow1000606024togmtstring path documentcookie3
items are available3
forvar i 03
10 else if3
iftypeof adalyserdatalayer undefined3
colored transitioncolor 025s3
coats come rain3
rain or shine3
stylish coats come3
wear statement sleeves3
summer tops summer3
most flattering fabric3
fabric in fashion3
colored color000000important transitioncolor3
find a store3
timed-banner colored transitioncolor3
background-repeat no-repeat background-size3
color000000important transitioncolor 025s3
025s ease26
ease 0s24
mark heyes9
background-color 025s6
0s background-color6
tunics trousers6
0s border-color6
swim amp6
opacity 025s6
0s opacity6
border-color 025s6
amp beachwear6
amp tunics6
tops amp6
amp shirts6
blouses amp6
transitioncolor 025s6
shirts coats6
coats amp6
jackets dresses6
amp jackets6
t-shirts tops6
fashion mark5
background-repeat no-repeat5
collect in-store5
free collect5
over 355
expires new5
free delivery5
path documentcookie4
background-position right4
new datenow1000606024togmtstring4
datenow1000606024togmtstring path4
else if4
background-position center4
function var4
lookbook free4
season lookbook4
delivery over4
accessories amp4
new season4
vertical-align middle4
currently not4
background-position left4
jeans knitwear4
ann harvey4
trousers amp4
dresses jeans4
inspire me4
lingerie amp4
amp nightwear4
height 22px4
amp shorts4
amp footwear4
knitwear lingerie4
learn more3
my account3
remaining items3
gift certificate3
0 landingpage3
womens clothing3
iftypeof adalyserdatalayer3
adalyserdatalayer undefined3
10 else3
landingpagereferrer documentreferrer3
0 sessionstart3
0 lastvisit3
landingpage documentlocationhref3
https documentlocationprotocol3
gift cards3
flattering fabric3
most flattering3
come rain3
coats come3
no-repeat background-size3
display inline-block3
margin 03
timed-banner colored3
colored transitioncolor3
stylish coats3
statement sleeves3
tops summer3
summer tops3
0 width3
bonus club3
catalogue request3
wear statement3
colored color000000important3
color000000important transitioncolor3
0 03
amp47
044
025s26
ease26
0s24
enter21
new20
var20
all14
summer13
function12
background-position12
if11
free11
trousers11
lingerie11
top10
valid10
accessories10
mark9
heyes9
tops9
coats9
sessionstart8
please8
18
nightwear8
t-shirts8
not8
skirts8
swim8
dresses8
height7
bonus7
delivery7
lastvisit7
else7
content7
offers7
more7
you7
blouses6
22px6
background-color6
shirts6
opacity6
available6
in-store6
your6
value6
border-color6
sale6
fashion6
true6
colored6
margin6
beachwear6
transitioncolor6
shorts6
gift6
center6
bottom6
jackets6
tunics6
jeans6
lookbook6
knitwear6
left6
23px5
normal5
no-repeat5
width5
over5
25
most5
documentcookie5
now5
landingpagereferrer5
background-repeat5
expires5
clothing5
undefined5
sign5
iftypeof5
path5
firstvisit5
landingpage5
c5
items5
https5
35
collect5
request5
middle4
season4
adalyserdatalayer4
vertical-align4
currently4
textjavascript4
forvar4
have4
datenow1000606024togmtstring4
right4
gbp4
holiday4
sizes4
usd4
harvey4
shop4
swimwear4
wear4
important4
me4
inspire4
site4
eur4
auto4
footwear4
display4
search4
store4
ann4
documentcreateelementscript3
documentlocationprotocol3
catalogue3
find3
statement3
than3
remaining3
url3
documentgetelementsbytagnamescript03
triggermail3
club3
sleeves3
cards3
return3
43
dorina3
documentreferrer3
register3
womens3
documentlocationhref3
isnewsession3
card3
can3
background-size3
bonmarch3
up3
us3
learn3
font-size3
line-height3
timed-banner3
color000000important3
displayinline-block3
inline-block3
font-weight3
src3
my3
account3
item3
rain3
certificate3
browser3
stylish3
come3
shine3
flattering3
cookies3
information3
order3
change3
credit3
fabric3
date3

Who hosts Bonmarche.co.uk?

Bonmarche.co.uk Hosting Provider Information

Hosted IP Address:212.25.233.88
Hosted Hostname:212.25.233.88
Service Provider:Venda Limited
Hosted Country:United KingdomGB
Location Latitude:51.5085
Location Longitude:-0.12574
Webserver Software:Not Applicable

Is "Venda Limited" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
16.3509%
Unknown
7.9282%
AS-26496-GO-DADDY-COM-LLC
4.2120%
NAMECHEAP-NET
3.4686%
AMAZON-AES
2.5797%
GoDaddy.com, LLC
2.3421%
UNIFIEDLAYER-AS-1
2.2322%
Fara Negar Pardaz Khuzestan
1.8901%
CONFLUENCE-NETWORK-INC
1.6374%
1&1 Internet AG
1.5839%
Venda Limited
0.0000%

HTTP Header Analysis for Bonmarche.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache
Vary: Accept-Encoding
Cache-control: no-cache
Content-Type: text/html; charset=ISO-8859-1
Content-Encoding: gzip
P3P: policyref="/w3c/p3p.xml", CP="CAO PSA OUR"
Date: Fri, 19 Jun 2015 05:50:36 GMT
Expires: -1
Transfer-Encoding: chunked
Connection: Keep-Alive
X-venda-hitid: 26553d6

Bonmarche.co.uk Domain Nameserver Information

HostIP AddressCountry
ans1.cw.net 141.1.27.248Germany Germany


Need to find out who hosts Bonmarche.co.uk?


Domain Registration (WhoIs) information for Bonmarche.co.uk

 Domain name:
bonmarche.co.uk

Registrant:
Bonmarche Ltd

Registrant type:
UK Limited Company, (Company number: 07909526)

Registrant's address:
Jubilee Way
Grange Moor
Wakefield
West Yorkshire
WF4 4SJ
United Kingdom

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 15-Dec-2014

Registrar:
Vodafone Limited [Tag = VODAFONE]

Relevant dates:
Registered on: 25-Jun-1998
Expiry date: 25-Jun-2018
Last updated: 24-Jun-2017

Registration status:
Registered until expiry date.

Name servers:
ans1.cw.net
ans2.cw.net

WHOIS lookup made at 04:46:00 26-Aug-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Bonmacalindong.com
Bon Macalindong
Bonmacaronpatisserie.com
Bon Macaron Patisserie
Bonmache.net
bonmache.net
Bonmag.com
HugeDomains.com
Bonmails.com
This site is under development
Bonmaison.com
HugeDomains.com

Recently Updated Websites

Broadheadlogistics.com (6 seconds ago.)Uclaparking.info (7 seconds ago.)Que-talk.com (9 seconds ago.)Duckreign.com (16 seconds ago.)Curryfriedchicken.com (17 seconds ago.)Trumpwasworse.com (24 seconds ago.)Blacksandbay.com (24 seconds ago.)Blaqkmusic.com (28 seconds ago.)Weinmvc.link (31 seconds ago.)Affinityesolutions.com (31 seconds ago.)Gopoliticalblog.com (32 seconds ago.)Siirena.com (39 seconds ago.)Be-aware-official.com (44 seconds ago.)Tghtsuccessteam.com (44 seconds ago.)Jcwilkinsplumbing.com (45 seconds ago.)Nagemall.com (50 seconds ago.)Splendibeauty.com (52 seconds ago.)Betterdigitalnow.com (53 seconds ago.)Burritosylocosgt.com (57 seconds ago.)Jazzysport.com (57 seconds ago.)Blacksmithingclassesnearme.com (57 seconds ago.)Sciencewear.net (58 seconds ago.)Clairecarson.com (1 minute 1 second ago.)Hdosrilanka.lk (1 minute 2 seconds ago.)Denrace.net (1 minute 7 seconds ago.)Mannafortoday.net (1 minute 10 seconds ago.)Wheelfinance.com (1 minute 11 seconds ago.)Tradingpostestateslaes.com (1 minute 13 seconds ago.)Eurocircuits.com (1 minute 14 seconds ago.)Golazovids.com (1 minute 19 seconds ago.)

Recently Searched Keywords

大腿伤后肿块现,瘤或非瘤请你研!(有病理结果) (1 second ago.)category book (1 second ago.)qpad®|mk75 pro gaming mechanical cherry mx keyboard (4 seconds ago.)s1s2s3s4s5s6s7s8s9s10s11s12s13s14s15s16s17s18s19s20s21s22s23s24s25s26s27s28s29s30s31s32s33s34s35s36s37s38s39s40s41s42s43s44s45s46s47s48s49s50s51s52s53s54s55s56s57s58s59s60s61s62s63s64s65s66s67 (4 seconds ago.)soho karen (6 seconds ago.)paco-少妇就是诱 (7 seconds ago.)hur (10 seconds ago.)phm vt (11 seconds ago.)auto moto si (12 seconds ago.)fysieke afspraken (13 seconds ago.)entertaining dinnerware and barware (14 seconds ago.)��ĵ���Դ����ʷ (15 seconds ago.)тёмное наследие (16 seconds ago.)go see a spacex launch (19 seconds ago.)week 6 (20 seconds ago.)et-pb-icontransitioncolor 300ms ease (20 seconds ago.)giveaway (20 seconds ago.)2018 read more (23 seconds ago.)16pj (23 seconds ago.)trendymenshaircuts (26 seconds ago.)новинки (27 seconds ago.)öffnungszeiten (28 seconds ago.)muschi (28 seconds ago.)height100 important (30 seconds ago.)pension plan (30 seconds ago.)tratados (31 seconds ago.)src localspinnaker localspinnaker-regular (31 seconds ago.)accessory panda hat (31 seconds ago.)data-product-id6682526843046quickbuy-form quickbuyproduct-media-1 width (32 seconds ago.)data-product-id6682526843046quickbuy-form quickbuyproduct-media-1 width (33 seconds ago.)