|  Könyv | bookline
Low trust score  | 
Újdonságok, bestsellerek, régi és új kedvencek nagy kedvezménnyel! Folyamatosan frissülő akciók, krimi, romantika, életmód, gasztronómia, szépirodalom. Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:49,884
Majestic Rank Majestic Rank:215,799
Domain Authority Domain Authority:52%
DMOZ DMOZ Listing:No

Domain Information for

Domain Registrar: HUNIC
Registration Date:2001-04-15  1 decade 8 years 1 month ago

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Whois server 2.08d serving the hu ccTLD

record created: 2001.04.15 03:01:24
További adatokért ld.:
For further data see:

Who hosts is hosted by INTEGRITY Informatics Ltd. in Budapest Fovaros, Budapest, Hungary, 1012. has an IP Address of and a hostname of and runs Apache/2.2.16 web server. Web Server Information

Hosted IP Address:
Service Provider:INTEGRITY Informatics Ltd.
Hosted Country:HungaryHU
Location Latitude:47.5
Location Longitude:19.0833
Webserver Software:Apache/2.2.16

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 25 Jun 2015 12:15:57 GMT
Server: Apache/2.2.16
X-Powered-By: Servlet 2.4; JBoss-4.2.3.GA (build: SVNTag=JBoss_4_2_3_GA date=200807181439)/JBossWeb-2.0
Cache-control: private
Pragma: no-cache
Expires: -1
Vary: User-Agent,Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html;charset=UTF-8

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

gyermek s ifjsgivoninitfunctionnew swiperslidescontainer nextbuttonmunkanaplehetifjsgi hangosknyv hobbinagyonvasrnapignextbutton slidescontainernext prevbuttons ifjsgi hangosknyvamerikaitextdecorationprocessajaxmessagedataetargetami0200000003jelszavamfizetsnoneslidescontainerfunctionteljesnone footerfootereljegyzskert stovbbezotriamintlpjpnz befektetsaudioprocessajaxmessagedataetarget jsonreturngasztronmia gyermekekjelszavam vagy lpjcsak0rsport82fttlauto11pontprogramlista kosrbanemlegaltextjelszavam vagyletmdtanknyvszlk gyermekpaginationclickable true25pxeknyverotika ezotria gasztronmiabefektets zletknyv raktronaugusztus 31igdisplay blockletmd egszsgknyvekbookline expressegszsg erotika ezotriamarginright15 15email jelszirodalom kertcollpj be facebookkalzeneszrakoztat irodalom sztr62017 0200000003szlkregisztrlt felhasznlfunctiondata processajaxmessagedataetargetpreloadimages false lazyloadingbejelentkezem5swiperslidescontainer nextbutton9eacutesvrhatpreloadimagesidfacebookkalaugusztus 31ig 30knyvcolor 7fbd00marginbottom 17857emlazyloading truelineheight 1 marginbottomfontsize 14pxslidescontainer new12pontkiad 2017 0200000003segdknyv trsadalomtudomnyvagy lpjszakknyvmunkanap vagyslidescontainernextdisplayhangosknyv hobbiirodalom sztrbejelentkezem elfelejtettemslidescontainernext prevbutton slidescontainerprevnextbutton slidescontainernexthobbiaugusztustrue oninitfunctionelfelejtettemslidescontainerprevakcibanprevbutton slidescontainerprev slidesperviewslidesperview4trzsvsrli programvagy email jelsznbefektets zlet sport31ig 1bookline express knyvutazs2017 0150000006kiad 2017animus kiadszllts 1paddinglazyloadinggasztronmiaknyvkiadzlet sporthazlet sport szakknyvefelhasznlgyermekek s szlkszakknyv szmtstechnika szrakoztatlista1 munkanapkosrbaheightvagypaginationclickablevrhat megjelenssztrezotria gasztronmiajletmd egszsg erotikarow col ulgasztronmia gyermekek sbelpslibribookline zrtslidescontainernext prevbuttonraktron vrhat szlltsiftrtnelem utazs vallsnaptrszakknyv szmtstechnikasegdknyvswiperslidescontainer nextbutton slidescontainernext31ig 30befektetss szlk gyermektrsadalomtudomny termszettudomny trtnelemtrtnelem utazslexikon enciklopdiafooterfooter legaltext p1 munkanap vagy31igjelsz bejelentkezem elfelejtettemkert s laksjsonreturnmarginfloatgyermek segszsgegybirodalom sztr nyelvknyvteklasszikusszmtstechnika szrakoztat irodalompreloadimages falseexpress knyvkertmvszetbooksirodalom kert sfacebookkal belpstrue effectfalse lazyloading truerowifjsgi hangosknyvwidthanimus kiad 201714pxgyermekek svarzlettrtnelemswiperslidescontainerfunctiondata processajaxmessagedataetarget jsonreturnpnzleftvrhat szllts 1teljes listaraktronurlmunkanap vagy booklinevagyoklegaltext pjelszblocklibribooklineanimusgyermekekcolornewperotika ezotriakiad 2016lineheight 1regisztrltszmtstechnika szrakoztatlineheighthangosknyvfalse lazyloadinglexikonletmarginbottom3nbsp490nbspftprevbutton slidescontainerprevprevbuttonvagy emailpostordercartaddactionez01500000061 marginbottom 17857ememailszlltsmgknyvkiad 2017expressgyermektanknyv segdknyvmagyarkiad 2017 0150000006dvdteljes lista kosrba7fbd00slidescontainerprev slidesperviewtermszettudomny trtnelemmarginleftprocessajaxmessagedataetarget jsonreturn falsereturntrsadalomtudomny termszettudomnyajndkutalvnyokhogyfontsize7selectorfooterfooter row colnew swiperslidescontainerfalsetanknyv segdknyv trsadalomtudomnynone footerfooter rowszrakoztat irodalomenciklopdiacol ul lielfelejtettem a jelszavamegytrzsvsrliminden17857emfoldalvallszrtszrakoztatulsztr nyelvknyvexpress knyv raktronmegszlk gyermek ssfooterfooter legaltextcol ulwilliamadomnyles ifjsgiegszsg erotikajsonreturn falsetrsadalomtudomnybooklineeknyvolvasklakss szlkfelhasznlnv vagy emailemail jelsz bejelentkezemraktron vrhatszmtstechnikamegjelenseffectrow collooputazs vallsfelhasznlnv vagys lakseltermszettudomny trtnelem utazsidegenaz oldalsport szakknyv szmtstechnikaezotria gasztronmia gyermekekaugusztus 31ig 1functiondatafooterfooterlivagy booklineerotikasegdknyv trsadalomtudomny termszettudomnyidegen nyelvtermszettudomny3float leftsport szakknyvnextbuttonkiadtrueheight autovagy bookline expresshogyanfelazul lifelhasznlnvirodalomifjsgi1nyelvknyvoldal1 marginbottomslidescontainer new swiperslidescontainernepnz befektets zletnyelvjelsz bejelentkezemszllts 1 munkanapvrhat szlltsfooterfooter row

Longtail Keyword Density for

functiondata processajaxmessagedataetarget jsonreturn13
processajaxmessagedataetarget jsonreturn false13
vagy bookline express11
munkanap vagy bookline11
1 munkanap vagy11
raktron vrhat szllts11
vrhat szllts 111
szllts 1 munkanap11
bookline express knyv11
express knyv raktron11
footerfooter row col10
row col ul7
col ul li6
kiad 2017 02000000035
termszettudomny trtnelem utazs4
tanknyv segdknyv trsadalomtudomny4
trsadalomtudomny termszettudomny trtnelem4
none footerfooter row4
kiad 2017 01500000064
kert s laks4
segdknyv trsadalomtudomny termszettudomny4
gyermekek s szlk4
gasztronmia gyermekek s4
egszsg erotika ezotria3
letmd egszsg erotika3
lpj be facebook-kal3
erotika ezotria gasztronmia3
ezotria gasztronmia gyermekek3
szlk gyermek- s3
jelszavam vagy lpj3
s szlk gyermek-3
animus kiad 20173
1 margin-bottom 17857em3
email jelsz bejelentkezem3
vagy email jelsz3
footerfooter legal-text p3
line-height 1 margin-bottom3
jelsz bejelentkezem elfelejtettem3
augusztus 31-ig 13
augusztus 31-ig 303
elfelejtettem a jelszavam3
teljes lista kosrba3
false lazyloading true3
szmtstechnika szrakoztat irodalom3
szrakoztat irodalom sztr3
irodalom sztr nyelvknyv3
ifjsgi hangosknyv hobbi3
szakknyv szmtstechnika szrakoztat3
sport szakknyv szmtstechnika3
pnz befektets zlet3
befektets zlet sport3
zlet sport szakknyv3
felhasznlnv vagy email3
s ifjsgi hangosknyv3
nextbutton slidescontainer-next prevbutton3
slidescontainer-next prevbutton slidescontainer-prev3
prevbutton slidescontainer-prev slidesperview3
preloadimages false lazyloading3
swiperslidescontainer nextbutton slidescontainer-next3
new swiperslidescontainer nextbutton3
gyermek- s ifjsgi3
trtnelem utazs valls3
slidescontainer new swiperslidescontainer3
irodalom kert s3
jsonreturn false13
processajaxmessagedataetarget jsonreturn13
functiondata processajaxmessagedataetarget13
vrhat szllts12
augusztus 31-ig12
footerfooter row12
bookline express11
express knyv11
vagy bookline11
munkanap vagy11
1 munkanap11
knyv raktron11
raktron vrhat11
szllts 111
kiad 201710
row col10
vrhat megjelens8
2017 02000000038
col ul7
display block7
footerfooter legal-text6
ul li6
2017 01500000065
s ifjsgi5
none footerfooter5
teljes lista5
trtnelem utazs4
szakknyv szmtstechnika4
termszettudomny trtnelem4
szrakoztat irodalom4
tanknyv segdknyv4
trsadalomtudomny termszettudomny4
kiad 20164
segdknyv trsadalomtudomny4
kert s4
gasztronmia gyermekek4
gyermekek s4
idegen nyelv4
regisztrlt felhasznl4
color 7fbd004
s szlk4
letmd egszsg4
s laks4
margin-bottom 17857em3
1 margin-bottom3
lista kosrba3
legal-text p3
lazyloading true3
true oninitfunction3
line-height 13
animus kiad3
31-ig 13
31-ig 303
float left3
knyvkiad 20173
height auto3
false lazyloading3
font-size 14px3
slidescontainer new3
szlk gyermek-3
ezotria gasztronmia3
erotika ezotria3
gyermek- s3
ifjsgi hangosknyv3
lexikon enciklopdia3
irodalom kert3
hangosknyv hobbi3
egszsg erotika3
facebook-kal belps3
vagy email3
felhasznlnv vagy3
az oldal3
email jelsz3
jelsz bejelentkezem3
vagy lpj3
jelszavam vagy3
bejelentkezem elfelejtettem3
pnz befektets3
befektets zlet3
nextbutton slidescontainer-next3
swiperslidescontainer nextbutton3
new swiperslidescontainer3
slidescontainer-next prevbutton3
prevbutton slidescontainer-prev3
true effect3
paginationclickable true3
slidescontainer-prev slidesperview3
libri-bookline zrt3
15 153
szmtstechnika szrakoztat3
sport szakknyv3
zlet sport3
irodalom sztr3
sztr nyelvknyv3
trzsvsrli program3
utazs valls3
preloadimages false3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Hungary Hungary Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?