Boxingnewsonline.net Website Analysis Summary

Boxingnewsonline.net  |  Boxing News - boxing news, results, rankings, schedules since 1909
Low trust score  | 
Boxing News - boxing news, results, rankings, schedules since 1909


Rank
624,064
Rating
G
Trust Score
Low Trust Score
Estimated worth
$2,160
Estimated daily income
$9
Estimated monthly income
$274
Backlinks
0

Boxingnewsonline.net has a Low Trust Score, and a Statvoo Rank of G.

Boxingnewsonline.net is hosted by UKfastnet Ltd in England, London, United Kingdom, Wc2n 5r.
Boxingnewsonline.net has an IP Address of 46.37.182.147 and a hostname of 46.37.182.147.srvlist.ukfast.net.

The domain boxingnewsonline.net was registered 1 decade 5 years 10 months ago by , it was last modified 4 years 11 months 1 week ago and currently is set to expire 3 years 10 months 1 week ago.

It is the world's 624,064 most popular site among over 300 million websites.

Boxingnewsonline.net has a total of 0 backlinks.

Boxingnewsonline.net gets approximately 1,410 unique visitors a day and 2,820 pageviews per day.

Boxingnewsonline.net has an estimated worth of $2,160.
An average daily income of approximately $9, which is wroughly $274 per month.

Whois information for boxingnewsonline.net

Full Whois Lookup for Boxingnewsonline.net Whois Lookup

Domain Name: BOXINGNEWSONLINE.NET
Registry Domain ID: 117304290_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: http://www.enom.com
Updated Date: 2017-03-17T08:31:12Z
Creation Date: 2004-04-15T20:14:45Z
Registry Expiry Date: 2018-04-15T20:14:45Z
Registrar: eNom, Inc.
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.NAMECITY.COM
Name Server: NS2.NAMECITY.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-19T06:13:31Z

Who hosts Boxingnewsonline.net?

Boxingnewsonline.net Web Server Information

Hosted IP Address:46.37.182.147
Hosted Hostname:46.37.182.147.srvlist.ukfast.net
Service Provider:UKfastnet Ltd
Hosted Country:United KingdomGB
Location Latitude:51.5085
Location Longitude:-0.12574
Webserver Software:Not Applicable

HTTP Header Analysis for Boxingnewsonline.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 14 Jul 2015 07:05:41 GMT
Server: Apache/2.4.9 (Win64) PHP/5.5.12
X-Powered-By: PHP/5.5.12
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Cookie
X-Pingback: http://www.boxingnewsonline.net/wordpress/xmlrpc.php
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Need to find out who hosts Boxingnewsonline.net?

Boxingnewsonline.net Free SEO Report

Website Inpage Analysis for Boxingnewsonline.net

H1 Headings:1
1
H2 Headings:1
5
H3 Headings:1
5
H4 Headings:1
0
H5 Headings:1
0
H6 Headings:1
0
Total IFRAMEs:0
Total Images:51
Google Adsense:Not Applicable
Google Analytics:UA-430968-16

Keyword Cloud for Boxingnewsonline.net

20 hourshoteltrainsframptonredrequirednews 2outputjquerydocumentreadyfunction5 daysbluntsupdateprogressslideindex progress progressbeginmurraylineheight0 left 0watch miguel cottoclassfunction updateprogressslideindex progressnorepeatago bn3pxwatchif youconor mcgregor trainingdefaultdisplaypiecesfloydgymfloyd mayweather revealsprogresspercent progressreveals whylink1function scaleslider vardefault value1slider2 days agoautoplay truescaleslider windowbindresize scaleslider136pxprogress progressbeginidlebegin0px left 0pxwhysoparentwidthcat3wants to fightspecify and enablewidth 100 heightallconor mcgregor reactsfloyd mayweathert jssort11rankingscat1cat1trim cat1cat1tolowercasewindowbindresize scaleslidergennady golovkinburnslink2 var link3consolelognothingleft 0px widthwindowsettimeoutscaleslider 30navigator instance chancetoshowdavid hayeoptions1pxwhile windowtablet else googletagcmdpushfunctionvegas gallerylink2if progress idleendforced to withdrawinstance0px width 136px2 alwaysjssorarrownavigatorjoshua100 progresselementstylewidth progresspercentjquerydocumentreadyfunction var optionsprogresselementstylewidthvar cat1 varnever 1packageeditor128pxitalicprogressbegin idlebeginpositionover hiswatch miguelrequired 0 neverwbo world16 hoursjssort11 pavimportantlink3 elsevegastouchassociationulpostcategoriesconor mcgregorpsecondhalfoutercaptiontimehours agomayweather vs98pxrequriedfontstyle italicvirtualporterlink3httpwwwboxingnewsonlinenetcat3darren8hallitalic fontsize 12pxlink1 var link2link1 elsearenaenable arrowpaddingifclink2 varcookietext var cat1slideindex1over 2 alwaysheight 72pxheavyweightanyvar cat2italic fontsize2 required 0press associationborder22 hours agoreveals why conorjosephdesktop ad tabletthumbnailsizecotto trainsad mobile else72px borderinstance chancetoshow 2elseupdateprogressmobile elseuserdevicegetclientwidth googletagcmdpushfunctionhaye discussesworldwhileprogress progressbegin idlebeginprogressend 0 ifshawn72px98px widthenablevar cat2 vararrowpressfunction scaleslider21 hourscat3cat3trim cat3cat3tolowercasecat1 varago press associationcat1cat3cat3trimprogressbeginidleend progressendklitschkodavid haye discusses16 hours agotonygreycat1cat1tolowercase136px height 98pxwladimirmayweather revealshtmlcanelo alvarez12px paddingdiscusses the mcgregornigelfunctionschedulegoposition absolute topbackgroundpositionnewsdesktopstaffcreate arrowdavid1 mousealwaysvar parentwidth0 widthviewcolor redsensationallypav canthonyprogress progressendcolor 2ssanslasfridisplay nonewidth 136px heightlink30width 128pxidlebegin idleend progressend000been136px height128px heightppdnnone jssort11betting oddsvs conormanchesterupskoglundmcgregor20 hours agojqueryhayefontsize 12pxwidth 136pxdaysoddstaff watch13bn shopbn stafffirst100 height 100ifmobilegetsizemaxmiguel cotto trainsneverarrownavigatoroptions optionalnever 1 mousemanuwaad tablet elseoptions autoplayagoshawn porter forcedchancetoshowautoplaytabletgetsizemax userdevicegetclientwidth consolelognothinghours ago bnbnyourridicule over hisautoplayintervalahead98px width 128pxterence crawford discusses3absolute topwindowbindorientationchange scaleslider varcodescaleslider var progresselementanthony joshua revealsvar link196pxcat2 var cat3view statsfloatif progressend 0scriptstatsbackgroundposition 50popularfear8217height 98px widthpauseifcat1photo gallery72px border 000cat2cat2trimprogresspercentfloat leftscaleslider varmayweathermcgregorvar options autoplaysportclass to createshowshopfurysfalse2ago watchhe wantsgigneywindowsettimeoutscaleslideradarrow navigatorclash22 hourstablet elsecat3cat3tolowercaseterence crawfordpostnigel benn sensationallyrequired 0options to specifyvideo 5 daysdayvideo 5mouse over 2georgepavad mobile10padding 5pxdate32pxtchallengehimmayweather vs conorhourswindowbindresize scaleslider windowbindorientationchangemiguel cottowidth 100valueautovar cat1mayweatherboxingcanbackgroundcreate arrow navigatormobile else ifpauseonhoverreaduserdevicegetclientwidthcottoheightchancetoshow 2chancetoshow 2 requiredyou cangoogletagcmdpushfunctionoptional optionsnoneago george gigneyprogress progressend 100workoutcookiesspecifyifcat2photo galleryjoseph parkercat1 var cat2100 progresselementstylewidthfontweightwindowbindload scalesliderover0 nevertouch deviceoptions autoplay truelink1 varodds1 2vmarginhad beenfreezeheight 72px bordercarl framptonshawn porterrssago pressheight 98pxidleend varporter forcedif parentwidthidleftrequried class5progressend iffffprogress21 hours agoprogressend 0fjsprogressend 100 progresselementstylewidthvar link30px widthcreateborder 000sharesolidtrainingdavid benavidezifcat2photoparkingpositionwindowsettimeoutscaleslider 30 scalesliderscaleslider windowbindorientationchange scalesliderbellew0 leftwithdrawvar a 0ridicule overwindowbindloadholderheight 100pxjssort11 phovergeorge gigneyv sonavigator or not1 mouse overprogress idleend varseparrow navigator instancemcgregor trainingsydneymousesportsanthony joshuanextwe5pxslideindex1 text varaugfontsize 12px padding9fontstyle italic fontsizenews 2 dayswindowbindresize2 requiredvalue is 1responsiveelse googletagcmdpushfunctionelse if tabletgetsizemaxifmobilegetsizemax userdevicegetclientwidth consolelognothingdesktop adjssorarrownavigator requriedfloyd mayweather vsodds on conorvideo conor mcgregorprogress idleendmayweathermcgregor show1 2 daysboutwindowbindorientationchange scaleslideruserdevicegetclientwidth consolelognothingwladimir klitschkotop 0japanifcat3photoknockoutprogressend 100wantrevealswhy conorhelink1httpwwwboxingnewsonlinenetcat1arrownavigatoroptionsnew datereturnnew40px12retirementnonavigator instancesensationally bluntsabsolutelatestjssort01progresspercent progress progressendclass jssorarrownavigator requriedvar link2 varago bn staffvar progresspercent progresstabsvar cat3bennconsolelognothing to outputif tabletgetsizemax12px padding 5pxmorewidth 128px heightparkertruenot class jssorarrownavigatorboxing newsjimi manuwatextlipavhoverhishistoryif tabletgetsizemax userdevicegetclientwidthpaperifmobilegetsizemax userdevicegetclientwidth googletagcmdpushfunctionbn staff watchjssort11magazine128px height 72pxtext var2sover 26hadyork hallyorkbenn sensationallywindowhours ago georgereacts to ridiculeelse windowsettimeoutscaleslider 300 ifif progressmiguel0 varidleend progressend ifboxing gymidleendprogressend if progressendcirculation2 dayswatch david hayemedia12px2pxscale sliderjoshua revealstopjoealvarezcat2cat2trim cat2cat2tolowercasewithdraw from mayweathermcgregordocumentfox30 scalesliderslidefontstyleday nigelprogresselementstylewidth progresspercent4height 100options functiontabletgetsizemax5 days agodocumentcookie0 if progresswbojsscalewindowbindorientationchangemayweather reveals whysatpauseonhover 1bettingfunction updateprogressslideindexvarupdateprogressslideindexthumbnail navigatortony bellew7tabletgetsizemax userdevicegetclientwidthterencevar optionsdevicevs conor mcgregorupdateprogressslideindex progressvar progresspercentforcedvirtual postdays ago bnlink2httpwwwboxingnewsonlinenetcat2parkingposition 0navigatorscaleslider windowbindresizescalesliderscaleslider windowbindload scaleslidernot classcrawford100pxvacantwidthwantscontenthughie furycat3 varinstance chancetoshowbackgroundcolorfightleft 0 widthdesktop ad mobileresultspathnamevar progresselementmcgregor challenge50 50hughiemouse overmcgregor reactsprogressbegin idlebegin idleendtabletholder vblackscaleslider windowbindloadoutput for desktopreactsjimi0 never 1succeededsunbenavidezvar link1 varcrawford discussesslideindex1 texttimesetday nigel bennhtml jssort01jquerydocumentreadyfunction vardays agonigel bennchangeif progressendgennadytermscarllink2 elsecat2cat2tolowercasetop 0px leftresponsive codec jssort11windowbindload scaleslider windowbindresizemullanjssort11 pavhovergolovkinyearsreveals where heifcat3photo galleryfindoptions function scalesliderwhiteplas vegas30 scaleslider windowbindloadleft 0pxcat22px solidnew editor100 heightad tabletvsfight nextprogressenditscat1cat1trimcontainerphoverconorpromotionsirandisplayvar link2youelse windowsettimeoutscaleslider11videofontsizegallerymobilearrownavigatoroptions optional optionsaftertop 0 leftcolorscaleslider windowbindorientationchangephover coptionalidlebegin idleenddragorientationridiculephotosthen0 var progresspercentifmobilegetsizemax userdevicegetclientwidthourifcat1photoposition absolutewatch david0px leftabsolute top 0else ifenable arrow navigatorago georgeerikvar cat3 vardiscussesvideo conor0pxbenn sensationally bluntserik skoglundbackgroundposition 50 50caneloleft 0progresselementtitlenotscaleslider var parentwidthjssorarrownavigator requried classufctop 0pxclass jssorarrownavigatorcat2 varcancelledcat3 var link1

Longtail Keyword Density for Boxingnewsonline.net

KeywordsOccurences
2 days ago15
consolelognothing to output14
output for desktop12
ago bn staff9
ifmobilegetsizemax userdevicegetclientwidth consolelognothing8
position absolute top8
if tabletgetsizemax userdevicegetclientwidth8
else if tabletgetsizemax8
22 hours ago8
tablet else googletagcmdpushfunction6
21 hours ago6
ad mobile else6
ad tablet else6
desktop ad mobile6
mobile else if6
tabletgetsizemax userdevicegetclientwidth consolelognothing6
desktop ad tablet6
width 128px height5
forced to withdraw5
128px height 72px5
scaleslider windowbindorientationchange scaleslider5
0px left 0px5
conor mcgregor reacts5
ago george gigney5
windowbindresize scaleslider windowbindorientationchange5
hours ago bn5
reacts to ridicule5
anthony joshua reveals5
reveals where he5
shawn porter forced5
scaleslider var parentwidth5
scaleslider windowbindresize scaleslider5
var options autoplay5
jquerydocumentreadyfunction var options5
else windowsettimeoutscaleslider 305
function scaleslider var5
windowbindload scaleslider windowbindresize5
left 0px width4
0 never 14
required 0 never4
mouse over 24
height 72px border4
136px height 98px4
1 mouse over4
over 2 always4
width 136px height4
never 1 mouse4
20 hours ago4
class to create4
navigator instance chancetoshow4
withdraw from mayweather-mcgregor4
98px width 128px4
specify and enable4
terence crawford discusses4
navigator or not4
height 98px width4
value is 14
options to specify4
top 0px left4
5 days ago4
days ago bn4
watch miguel cotto3
instance chancetoshow 23
arrow navigator instance3
chancetoshow 2 required3
jssorarrownavigator requried class3
conor mcgregor training3
2 required 03
miguel cotto trains3
create arrow navigator3
72px border 0003
vs conor mcgregor3
mayweather vs conor3
floyd mayweather vs3
video 5 days3
video conor mcgregor3
discusses the mcgregor3
news 2 days3
class jssorarrownavigator requried3
david haye discusses3
watch david haye3
ago press association3
0px width 136px3
background-position 50 503
ridicule over his3
wants to fight3
bn staff watch3
16 hours ago3
1 2 days3
day nigel benn3
if progressend 03
progressend 0 if3
progressend if progressend3
idleend progressend if3
progressbegin idlebegin idleend3
idlebegin idleend progressend3
0 if progress3
if progress idleend3
var progresspercent progress3
progresspercent progress progressend3
0 var progresspercent3
var a 03
progress idleend var3
progress progressbegin idlebegin3
updateprogressslideindex progress progressbegin3
12px padding 5px3
options autoplay true3
font-size 12px padding3
italic font-size 12px3
ifmobilegetsizemax userdevicegetclientwidth googletagcmdpushfunction3
font-style italic font-size3
options function scaleslider3
windowsettimeoutscaleslider 30 scaleslider3
scaleslider var progresselement3
function updateprogressslideindex progress3
windowbindorientationchange scaleslider var3
scaleslider windowbindload scaleslider3
30 scaleslider windowbindload3
progress progressend 1003
progressend 100 progresselementstylewidth3
benn sensationally blunts3
absolute top 03
nigel benn sensationally3
odds on conor3
mayweather reveals why3
reveals why conor3
top 0 left3
0 left 03
arrownavigatoroptions optional options3
enable arrow navigator3
100 height 1003
width 100 height3
left 0 width3
floyd mayweather reveals3
hours ago george3
cat1 var cat23
var cat2 var3
var cat1 var3
text var cat13
100 progresselementstylewidth progresspercent3
slideindex1 text var3
cat2 var cat33
var cat3 var3
var link2 var3
link2 var link33
link1 var link23
var link1 var3
cat3 var link13
not class jssorarrownavigator3
hours ago21
conor mcgregor21
days ago20
slideindex1 text16
2 days15
position absolute14
userdevicegetclientwidth consolelognothing14
desktop ad12
floyd mayweather11
ifmobilegetsizemax userdevicegetclientwidth11
boxing news10
ago bn9
bn staff9
default value8
anthony joshua8
if tabletgetsizemax8
else if8
22 hours8
tabletgetsizemax userdevicegetclientwidth8
scaleslider var8
absolute top8
carl frampton7
arrow navigator6
jssort11 pavhover6
21 hours6
tony bellew6
shawn porter6
terence crawford6
ad mobile6
ad tablet6
else googletagcmdpushfunction6
mobile else6
tablet else6
top 0px5
height 72px5
left 0px5
hughie fury5
padding 5px5
ago george5
128px height5
0px left5
options autoplay5
porter forced5
jquerydocumentreadyfunction var5
v so5
holder v5
jssort11 phover5
var options5
t jssort115
width 128px5
george gigney5
function scaleslider5
userdevicegetclientwidth googletagcmdpushfunction5
mouse over5
nigel benn5
windowsettimeoutscaleslider 305
var parentwidth5
if parentwidth5
else windowsettimeoutscaleslider5
david haye5
windowbindload scaleslider5
mcgregor reacts5
joshua reveals5
windowbindorientationchange scaleslider5
scaleslider windowbindorientationchange5
view stats5
windowbindresize scaleslider5
scaleslider windowbindresize5
color 2s4
las vegas4
5 days4
jssort11 pav4
new date4
gennady golovkin4
0 width4
joseph parker4
20 hours4
font-style italic4
font-size 12px4
if you4
72px border4
instance chancetoshow4
98px width4
height 98px4
width 136px4
136px height4
2 always4
required 04
chancetoshow 24
miguel cotto4
1 mouse4
never 14
0 never4
optional options4
0px width4
navigator instance4
not class4
ago watch4
scale slider4
over 24
while window4
responsive code4
crawford discusses4
thumbnail navigator4
touch device4
you can3
press association3
ago press3
wbo world3
york hall3
mayweather vs3
vegas gallery3
boxing gym3
mcgregor challenge3
canelo alvarez3
mayweather-mcgregor show3
news 23
height 100px3
border 0003
1 23
watch miguel3
html jssort013
50 503
2px solid3
background-position 503
wladimir klitschko3
video conor3
staff watch3
new editor3
16 hours3
fight next3
over his3
he wants3
had been3
watch david3
video 53
mcgregor training3
vs conor3
cotto trains3
haye discusses3
jimi manuwa3
ridicule over3
top 03
0 var3
var progresspercent3
progresspercent progress3
progress progressend3
idleend var3
progress idleend3
progressend 03
0 if3
if progress3
progressend 1003
100 progresselementstylewidth3
cat2 var3
var cat33
cat3 var3
var cat23
cat1 var3
progresselementstylewidth progresspercent3
text var3
var cat13
if progressend3
progressend if3
autoplay true3
pauseonhover 13
parkingposition 03
color red3
12px padding3
bn shop3
float left3
italic font-size3
options function3
30 scaleslider3
progressbegin idlebegin3
idlebegin idleend3
idleend progressend3
progress progressbegin3
updateprogressslideindex progress3
scaleslider windowbindload3
var progresselement3
function updateprogressslideindex3
var link13
link1 var3
left 03
width 1003
100 height3
0 left3
display none3
benn sensationally3
sensationally blunts3
none jssort113
height 1003
c jssort113
jssorarrownavigator requried3
requried class3
create arrow3
class jssorarrownavigator3
enable arrow3
pav c3
phover c3
arrownavigatoroptions optional3
day nigel3
betting odds3
ifcat1photo gallery3
link1 else3
cat2cat2trim cat2cat2tolowercase3
virtual post3
cat1cat1trim cat1cat1tolowercase3
var link23
link2 var3
var link33
ifcat2photo gallery3
link2 else3
reveals why3
why conor3
david benavidez3
mayweather reveals3
erik skoglund3
cat3cat3trim cat3cat3tolowercase3
ifcat3photo gallery3
link3 else3
2 required3
var70
ago41
039
138
237
if34
boxing33
else29
news26
height25
scaleslider25
jssort1125
mcgregor25
width24
conor22
hours21
days21
left20
video20
function20
userdevicegetclientwidth19
position18
fight17
v17
top16
color16
bn16
text16
slideindex116
none16
new16
desktop16
jssort0115
gallery15
c15
options14
ad14
output14
consolelognothing14
absolute14
optional13
mayweather13
anthony13
world13
editor13
312
you12
his12
solid12
0px12
press12
watch12
googletagcmdpushfunction12
training12
floyd11
sep11
over11
ifmobilegetsizemax11
he11
411
parentwidth11
true10
navigator10
510
background-position10
610
progress9
class9
progressend9
default9
staff9
border9
magazine9
background9
paper9
slider9
arrow8
value8
joshua8
reveals8
discusses8
tabletgetsizemax8
t8
david8
font-size8
title8
-40px8
murray7
promotions7
next7
frampton7
phover7
77
mayweather-mcgregor7
padding7
87
carl7
fff6
bellew6
mouse6
link36
link26
window6
tony6
sat6
day6
display6
pav6
heavyweight6
not6
arena6
pavhover6
sports6
3px6
link16
forced6
crawford6
idleend6
5px6
progresspercent6
96
false6
mobile6
thumbnail6
tablet6
106
terence6
our6
background-color6
return6
shawn6
porter6
its5
128px5
72px5
size5
so5
holder5
1px5
required5
schedule5
rankings5
jquery5
red5
enable5
jquerydocumentreadyfunction5
hughie5
vegas5
stats5
nigel5
benn5
fury5
115
mullan5
document5
odd5
withdraw5
windowbindresize5
windowbindorientationchange5
after5
show5
more5
125
important5
while5
first5
windowbindload5
windowsettimeoutscaleslider5
view5
gigney5
aug5
wbo5
betting5
george5
clash5
ridicule5
haye5
chancetoshow5
reacts5
pause5
autoplay5
sydney4
date4
then4
hotel4
had4
fri4
136px4
no4
scale4
touch4
vs4
device4
ufc4
challenge4
time4
golovkin4
gennady4
up4
photos4
cancelled4
miguel4
joseph4
cotto4
134
tabs4
parker4
98px4
workout4
gym4
100px4
media4
your4
las4
black4
html4
white4
p4
why4
2s4
italic4
32px4
line-height4
margin4
li4
auto4
latest4
96px4
font-weight4
12px4
displaypieces4
always4
font-style4
create4
never4
responsive4
specify4
can4
dragorientation4
code4
instance4
2px3
psecond-half-outer-caption-time3
content3
float3
0003
container3
freeze3
progresselement3
updateprogressslideindex3
any3
alvarez3
parkingposition3
slide3
sans3
autoplayinterval3
pauseonhover3
share3
find3
js3
terms3
fjs3
him3
popular3
succeeded3
years3
s3
documentcookie3
cookie3
cookies3
id3
script3
circulation3
package3
pathname3
trains3
grey3
ulpost-categories3
all3
canelo3
been3
no-repeat3
shop3
results3
we3
read3
wladimir3
set3
vacant3
odds3
knockout3
sensationally3
history3
benavidez3
retirement3
skoglund3
erik3
ahead3
association3
bout3
blunts3
iran3
sun3
japan3
darren3
jssorarrownavigator3
fox3
requried3
arrownavigatoroptions3
ppdn3
manchester3
sport3
joe3
hall3
york3
link3httpwwwboxingnewsonlinenetcat33
ifcat3photo3
cat1cat1trim3
cat33
cat1cat1tolowercase3
virtual3
burns3
post3
cat23
want3
progresselementstylewidth3
idlebegin3
updateprogress3
cat13
klitschko3
ifcat1photo3
rss3
fear82173
link2httpwwwboxingnewsonlinenetcat23
change3
cat3cat3trim3
wants3
cat3cat3tolowercase3
ifcat2photo3
jimi3
cat2cat2trim3
link1httpwwwboxingnewsonlinenetcat13
cat2cat2tolowercase3
go3
manuwa3
progressbegin3

What are the nameservers for boxingnewsonline.net?

Boxingnewsonline.net Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown