Attention Required! | Cloudflare

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 19,684
Estimated Worth: $772,560



Domain summary

Last updated
2021-11-21
Domain label
brainly
Domain extension
ph
Global Traffic Rank
19,684
Statvoo Rating
C
Trust Score
Low Trust Score
Estimated worth
$772,560
Estimated daily income
$1,073
Estimated monthly income
$32,637

Frequently Asked Questions (FAQ)

Q: When was Brainly.ph registered?
A: Brainly.ph was registered 2 weeks, 4 days, 13 hours, 35 minutes, 17 seconds ago on Sunday, November 21, 2021.
Q: When was the WHOIS for Brainly.ph last updated?
A: The WHOIS entry was last updated 2 weeks, 4 days, 13 hours, 35 minutes, 17 seconds ago on Sunday, November 21, 2021.
Q: Who is the registrar for the Brainly.ph domain?
A: The domain has been registered at .
Q: What is the traffic rank for Brainly.ph?
A: Brainly.ph ranks 19,684 globally on Alexa. Brainly.ph has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Brainly.ph each day?
A: Brainly.ph receives approximately 89,413 visitors and 536,478 page impressions per day.
Q: What IP address does Brainly.ph resolve to?
A: Brainly.ph resolves to the IPv4 address .
Q: In what country are Brainly.ph servers located in?
A: Brainly.ph has servers located in the .
Q: What webserver software does Brainly.ph use?
A: Brainly.ph is powered by CloudFlare webserver.
Q: Who hosts Brainly.ph?
A: Brainly.ph is hosted by Unknown in .
Q: How much is Brainly.ph worth?
A: Brainly.ph has an estimated worth of $772,560. An average daily income of approximately $1,073, which is roughly $32,637 per month.

Brainly.ph Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Brainly.ph Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Brainly.ph

H1 Headings

2 :
  1. One more step
  2. Please turn JavaScript on and reload the page.

H2 Headings

3 :
  1. Please complete the security check to access brainly.ph
  2. Why do I have to complete a CAPTCHA?
  3. What can I do to prevent this in the future?

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Brainly.ph

pagenetworkyouryoupleasecan

Longtail Keyword Density for Brainly.ph

KeywordsOccurences
you7
please5
your3
page3
can3
network3

Who hosts Brainly.ph?

Brainly.ph Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:CloudFlare

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%

HTTP Header Analysis for Brainly.ph

Http-Version: 1.1
Status-Code: 403
Status: 403 Forbidden
Date: Sun, 21 Nov 2021 04:50:36 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: close
CF-Chl-Bypass: 1
Permissions-Policy: accelerometer=(),autoplay=(),camera=(),clipboard-read=(),clipboard-write=(),fullscreen=(),geolocation=(),gyroscope=(),hid=(),interest-cohort=(),magnetometer=(),microphone=(),payment=(),publickey-credentials-get=(),screen-wake-lock=(),serial=(),sync-xhr=(),usb=()
Cache-Control: private, max-age=0, no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Expires: Thu, 01 Jan 1970 00:00:01 GMT
X-Frame-Options: SAMEORIGIN
Vary: Accept-Encoding
Server: cloudflare
CF-RAY: 6b174c548899068e-LHR
Content-Encoding: gzip

Brainly.ph Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Brainly.ph?


Domain Registration (WhoIs) information for Brainly.ph

Websites with Similar Names

Brain--injury--lawyers.com
Traumatic Brain Injury Lawyers in Virginia Beach | TBI Attorneys in Norfolk, VA | Shapiro, Appleton & Washburn
Brain-3.net
Loading...
Brain-8-activity.com
Just another WordPress site│hara
Brain-abundance.com
BrainAbundance :: WELCOME!
Brain-admin.com
SB Admin 2 - Login
Brain-adv.com
401 Authorization Required

Recently Updated Websites

Inunositukeyasan.com (5 seconds ago.)Buyplaya.com (5 seconds ago.)Oslobraincentre.com (6 seconds ago.)Billionairemama.com (7 seconds ago.)Asktamipodcast.com (7 seconds ago.)Cio.go.jp (7 seconds ago.)Nordic-advisors.com (8 seconds ago.)Thc-ministry.net (9 seconds ago.)Click-learn.info (11 seconds ago.)Lucyinstitches.com (12 seconds ago.)Qaabilsolutions.com (14 seconds ago.)Zi-sheng.com.tw (14 seconds ago.)Personal.lse.ac.uk (14 seconds ago.)Kelseyskaarva.com (16 seconds ago.)Engvud.com (16 seconds ago.)Cleanandfix.sg (17 seconds ago.)Theshoppingangels.com (17 seconds ago.)Biaozhengjichuang.com (18 seconds ago.)Wdws.com (18 seconds ago.)Emicroentrepreneur.com (19 seconds ago.)Amgpartsandservicecenters.com (20 seconds ago.)Tatilruyasi.com (20 seconds ago.)Novomind-mea-iagent.com (21 seconds ago.)Feederbuy.ru (21 seconds ago.)1moviechannel.com (24 seconds ago.)Signaltrap.us (24 seconds ago.)Jiangtao2.com (26 seconds ago.)Nindya.net (26 seconds ago.)Guldfors.se (26 seconds ago.)Danfyvie.com (29 seconds ago.)

Recently Searched Keywords

heat recovery (1 second ago.)corporate displays (1 second ago.)farfetch uk (2 seconds ago.)read more about us > (2 seconds ago.)phụ nữ tuổi 40 (2 seconds ago.)181 119 important (2 seconds ago.)qweqweqweqwe op gg (2 seconds ago.)child start (3 seconds ago.)kat (3 seconds ago.)loveleexd21 (4 seconds ago.)maxinegh_ (5 seconds ago.)ast-widget-icon svg (6 seconds ago.)fireworks displays (6 seconds ago.)pyrotechnic displays (6 seconds ago.)formproduct-form (6 seconds ago.)icelandair hotel (7 seconds ago.)assigned names (7 seconds ago.)160 600 (7 seconds ago.)0 cb9c0d (7 seconds ago.)solutionsqqlocationqqfaisalabad pakistanqqlogoqqemployers-hot-job3d35bda431d34d149f32d7598ba2bccajpgqqadtypeqqgalleryqqsavedqfalseqtypeqqfull (7 seconds ago.)заработок на игре world of warcraft (8 seconds ago.)your corporate (8 seconds ago.)bosto tablet website (8 seconds ago.)professional fireworks (8 seconds ago.)fantaziafireworks (9 seconds ago.)56 iq android (9 seconds ago.)click here for more information on wedding fireworks displays. (9 seconds ago.)geode bodywork (10 seconds ago.)jennifer miller (10 seconds ago.)how to clean a sex doll (10 seconds ago.)