Bricktopia.de  |  Bricktopia - Das deutschsprachige LEGO® Blog Bricktopia wird von LEGO®-Fans als inoffizielle LEGO®-Fanseite betrieben. Bricktopia beschäftigt sich mit Plastikspielzeug wie LEGO, Mega Bloks oder Kre-O und bedient nicht nur Hardcore LEGO-Fans. Themenwelten wie Apocalego oder Steampunk spielen eine zentrale Rolle. : Bricktopia
Low trust score  | 
Das deutschsprachige LEGO® Blog Bricktopia wird von LEGO®-Fans als inoffizielle LEGO®-Fanseite betrieben. Bricktopia beschäftigt sich mit Plastikspielzeug wie LEGO, Mega Bloks oder Kre-O und bedient nicht nur Hardcore LEGO-Fans. Themenwelten wie Apocalego oder Steampunk spielen eine zentrale Rolle.




Bricktopia.de Website Information

Website Ranks & Scores for Bricktopia.de

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:10,611,292
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:23%
DMOZ DMOZ Listing:No

Whois information for bricktopia.de

Full Whois Lookup for Bricktopia.de Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Bricktopia.de. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: bricktopia.de
Nserver: ns.namespace4you.de
Nserver: ns2.namespace4you.de
Status: connect
Changed: 2017-06-22T10:20:14+02:00

[Tech-C]
Type: ROLE
Name: Hostmaster Domainfactory
Address: Domainfactory GmbH
Address: Oskar-Messter-Strasse 33
PostalCode: 85737
City: Ismaning
CountryCode: DE
Phone: +49 89 55266 0
Fax: +49 89 55266 222
Email: Login to show email
technical/domain issues only please
Changed: 2003-08-25T10:33:47+02:00

[Zone-C]
Type: ROLE
Name: Hostmaster Domainfactory
Address: Domainfactory GmbH
Address: Oskar-Messter-Strasse 33
PostalCode: 85737
City: Ismaning
CountryCode: DE
Phone: +49 89 55266 0
Fax: +49 89 55266 222
Email: Login to show email
technical/domain issues only please
Changed: 2003-08-25T10:33:47+02:00

Who hosts Bricktopia.de?

Bricktopia.de is hosted by domainfactory GmbH in North Rhine-westphalia, Hoest, Germany, 47652.
Bricktopia.de has an IP Address of 46.252.18.182 and a hostname of anguilla.ispgateway.de and runs Apache/2.4.10 web server.



Bricktopia.de Web Server Information

Hosted IP Address:46.252.18.182
Hosted Hostname:anguilla.ispgateway.de
Service Provider:domainfactory GmbH
Hosted Country:GermanyDE
Location Latitude:51.65
Location Longitude:6.1833
Webserver Software:Apache/2.4.10

HTTP Header Analysis for Bricktopia.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 17 Dec 2015 10:16:53 GMT
Server: Apache/2.4.10
X-Powered-By: PHP/5.2.17
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-Pingback: http://bricktopia.de/xmlrpc.php
Link:; rel=shortlink
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8


Need to find out who hosts Bricktopia.de?

Bricktopia.de Free SEO Report

Website Inpage Analysis for Bricktopia.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Bricktopia.de

berlinwanntheorytheory wohnzimmer 8211esread moresieoder so hnlichimcommentszursitcom umcustomizerknnenalternativerlego9hellip by oliverlachern damit du1 comments read2014 0 commentswurdezweionlinetime markus8216 alternativerviererfolgreiche sitcom um8211 einbei legolego investing 8211bang theoryder ganzenprimeeinenes lustiglacherndamit dujuniinterviewsrarrum viercomments read morestorecustomswenn manseitsache esnachsptentimewann esmoreduam spten nachmittagweit wannbricktheory wohnzimmerheit es wennneueverdienen mit legosteinendiese erfolgreichebigauch weit wannist diese erfolgreicheuns0 commentslego minifigurenmocs8211 ein interviewlego blogs 8212blogspten nachmittagstar wars2014 2 commentsshopbazinga oderbaneder6demblogs 8212deutschlandblogslustig das istder hellipim lego storedas ist dieseartikelaugust 2014reinzieht diesewarminifiguren5 commentsganzen sache eslegosteinenoktobertypischamerikanische sitcom mitist sogar lustigreviews mocsread more rarrwennsindist sogareingespielten1diesesitcom um viertime markus82162verdienen mitamsogar lustig dascustomdas ist7bricktopiaman am sptenwenn man ammit eingespielten lachernes ist sogarlego storevier nerdsausrarr lego8shopsganzenmeine0es wenn manbang theory reinziehtnachmittag amazon primees isteine folge big2 commentsheitberlinerist das lustigsteumum vier nerds8212immer2014 0amazon primeweit wann esam sptenjahrediese typischamerikanische sitcomoderwohnzimmer 8211erfolgreiche sitcomlego blogsgeldsachefrfolge big bangdenamazoninterview bazinga oderwiedersich eine folgealsmitmaueranmachtmandamit du auch5videosoktober 2014vorhellip by banedas teamsichinvesting 8211man amnachmittagtypischamerikanische sitcommit legosteinen sets4zumaberheuteinterview bazingaberfolgelachern damitweitanderevon legowohnzimmerdacaptainsmogmocs setssteampunk time markus8216spten nachmittag amazonnachmittag amazonsteampunk timegeld verdienen miteine folgeso hnlicherfolgreichealtmal wiederteammore rarr legodiese typischamerikanischehellipaugustmalreviewshnlich heit esmocs sets shopslego architectureminifigsmore rarrmit demhnlicheineslustig ist dastypischamerikanischewirtastaturseinauch8211 geld verdienenamazon prime anmachtder legosogar lustiglegosteinen sets3setswiesich einemchteeingespielten lachern damitbei8211 gelddasoktober 2014 0wohnzimmer 8211 einhnlich heitreinziehtprime anmachtsobangberliner mauerlustig istteillego ideaswann es lustigdu auch weiteuchistder ganzen sachelustiginterviewtagmit eingespielteneine1 commentsmarkus8216 alternativer atatbang theory wohnzimmerlego architecture studiodiereviews mocs setsein interview bazingaist diesedesguteventshierlustigste an derso hnlich heit5 comments readanmacht und sichlego investingverdienenbrickssets shopssitcom mit eingespielten11das lustigstereadheit esaus legoeinoliver2 comments readideasim legomarkus8216sitcom mitbazingaichbloggerbazinga oder sonerds und hellipdiese erfolgreiche sitcomsitcomauch weitnichtfolge bigthemaaufgeld verdienenein interview2014 2juni 2013markus8216 alternativerganzen sachelustigstedu auchsogares lustig iststudiotheory reinzieht diesereinzieht diese typischamerikanischehatist das0 comments readbei lego investingsteampunkserie 12zuatatarchitecturetheory reinziehtes wenn10mit legosteineneingespielten lachernvonarchitecture studionerdsdamitalternativer atatcomments readwarsbig bang theorysache es isteinerreality8220investingstarmeinerinvesting 8211 geldhabelustig dasbrickstripbig bangoder soserie

Longtail Keyword Density for Bricktopia.de

KeywordsOccurences
read more rarr22
comments read more22
0 comments read11
2014 0 comments11
hellip by oliver10
hellip by bane7
big bang theory6
geld verdienen mit5
oktober 2014 05
mit lego-steinen -sets5
verdienen mit lego-steinen5
im lego store4
lego architecture studio4
steampunk time markus82164
time markus8216 alternativer4
1 comments read4
2 comments read4
lustig das ist3
das ist diese3
ist diese erfolgreiche3
diese erfolgreiche sitcom3
sogar lustig das3
es ist sogar3
der ganzen sache3
lustigste an der3
ganzen sache es3
sache es ist3
erfolgreiche sitcom um3
ist sogar lustig3
um vier nerds3
ist das lustigste3
investing 8211 geld3
lego investing 82113
bei lego investing3
8211 geld verdienen3
5 comments read3
2014 2 comments3
nerds und hellip3
more rarr lego3
markus8216 alternativer at-at3
sitcom um vier3
es lustig ist3
es wenn man3
heit es wenn3
hnlich heit es3
so hnlich heit3
wenn man am3
man am spten3
nachmittag amazon prime3
spten nachmittag amazon3
am spten nachmittag3
oder so hnlich3
bazinga oder so3
bang theory wohnzimmer3
mocs sets shops3
reviews mocs sets3
theory wohnzimmer 82113
wohnzimmer 8211 ein3
interview bazinga oder3
ein interview bazinga3
8211 ein interview3
amazon prime anmacht3
anmacht und sich3
damit du auch3
lachern damit du3
eingespielten lachern damit3
du auch weit3
auch weit wann3
lego blogs 8212-3
wann es lustig3
weit wann es3
mit eingespielten lachern3
sitcom mit eingespielten3
folge big bang3
eine folge big3
sich eine folge3
bang theory reinzieht3
theory reinzieht diese3
typisch-amerikanische sitcom mit3
diese typisch-amerikanische sitcom3
reinzieht diese typisch-amerikanische3
lustig ist das3
comments read22
more rarr22
read more22
0 comments11
2014 011
lego store8
oktober 20147
mit lego-steinen7
lego architecture6
big bang6
lego investing6
bang theory6
star wars6
geld verdienen5
verdienen mit5
lego-steinen -sets5
2 comments4
der lego4
mit dem4
markus8216 alternativer4
1 comments4
von lego4
oder so4
architecture studio4
im lego4
steampunk time4
ein interview4
time markus82164
ist diese3
diese erfolgreiche3
erfolgreiche sitcom3
um vier3
alternativer at-at3
mal wieder3
vier nerds3
sitcom um3
berliner mauer3
rarr lego3
juni 20133
lego ideas3
bei lego3
8211 geld3
investing 82113
august 20143
5 comments3
das ist3
2014 23
aus lego3
der hellip3
serie 123
lego minifiguren3
das team3
es ist3
am spten3
man am3
wenn man3
es wenn3
spten nachmittag3
nachmittag amazon3
eine folge3
sich eine3
prime anmacht3
amazon prime3
heit es3
hnlich heit3
sets shops3
mocs sets3
reviews mocs3
blogs 8212-3
theory wohnzimmer3
wohnzimmer 82113
so hnlich3
bazinga oder3
interview bazinga3
8211 ein3
folge big3
theory reinzieht3
das lustigste3
ist das3
lustig ist3
es lustig3
der ganzen3
ganzen sache3
sogar lustig3
ist sogar3
lego blogs3
sache es3
wann es3
weit wann3
sitcom mit3
typisch-amerikanische sitcom3
diese typisch-amerikanische3
reinzieht diese3
mit eingespielten3
eingespielten lachern3
auch weit3
du auch3
damit du3
lachern damit3
lustig das3
lego57
der40
mit31
more24
hellip24
023
von23
comments22
rarr22
read22
die22
das18
im17
ein17
ist17
ich16
bricktopia15
auf15
115
es14
auch12
heute12
212
oder11
310
410
eine10
oliver10
aus10
minifiguren10
fr10
dem9
sich9
bane9
wir9
captainsmog9
oktober9
zu9
diese8
sind8
steampunk8
bei8
am8
store8
57
du7
67
lego-steinen7
den7
brick7
interview7
lustig6
artikel6
wie6
theory6
star6
big6
bang6
wars6
investing6
so6
als6
architecture6
jahre6
sets6
sitcom6
um5
mal5
neue5
uns5
geld5
events5
man5
-sets5
verdienen5
team5
folge5
thema5
meiner5
juni5
zur5
gut5
vor5
wenn5
berliner5
zum5
alternativer4
nicht4
war4
studio4
74
berlin4
des4
84
bricks4
markus82164
hier4
brickstrip4
meine4
habe4
customs4
time4
einen4
mchte4
wieder4
wurde3
hat3
da3
euch3
aber3
august3
93
bazinga3
heit3
mauer3
lustigste3
deutschland3
wann3
weit3
serie3
damit3
lachern3
hnlich3
nachmittag3
spten3
ideas3
reinzieht3
prime3
anmacht3
typisch-amerikanische3
eingespielten3
alt3
amazon3
wohnzimmer3
tastatur3
reality82203
eines3
blog3
ber3
videos3
minifigs3
sein3
andere3
interviews3
shop3
103
zwei3
customizer3
immer3
at-at3
shops3
mocs3
reviews3
knnen3
einer3
online3
erfolgreiche3
113
blogs3
teil3
sogar3
sache3
tag3
8212-3
vier3
blogger3
seit3
nach3
sie3
custom3
nerds3
ganzen3

What are the nameservers for bricktopia.de?

Bricktopia.de Domain Nameserver Information

HostIP AddressCountry
ns.namespace4you.de 80.67.16.124Germany Germany
ns2.namespace4you.de 193.223.77.3Germany Germany

Bricktopia.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Bricktopia.de is a scam?