Brigugl.io

Louise Briguglio

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-30
Category: This site has not been categorized yet


Domain summary

Domain label
brigugl
Domain extension
io
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is brigugl.io ranked relative to other sites:

Percentage of visits to brigugl.io from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Brigugl.io registered?
A: Brigugl.io was registered 1 month, 6 days, 5 hours, 3 minutes, 37 seconds ago on Friday, October 30, 2020.
Q: When was the WHOIS for Brigugl.io last updated?
A: The WHOIS entry was last updated 1 month, 6 days, 5 hours, 3 minutes, 37 seconds ago on Friday, October 30, 2020.
Q: What are Brigugl.io's nameservers?
A: DNS for Brigugl.io is provided by the following nameservers:
  • c.dns.gandi.net
  • b.dns.gandi.net
  • a.dns.gandi.net
Q: Who is the registrar for the Brigugl.io domain?
A: The domain has been registered at .
Q: What is the traffic rank for Brigugl.io?
A: Brigugl.io has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Brigugl.io each day?
A: Brigugl.io receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Brigugl.io resolve to?
A: Brigugl.io resolves to the IPv4 address 198.185.159.145.
Q: In what country are Brigugl.io servers located in?
A: Brigugl.io has servers located in the United States.
Q: What webserver software does Brigugl.io use?
A: Brigugl.io is powered by Squarespace webserver.
Q: Who hosts Brigugl.io?
A: Brigugl.io is hosted by Squarespace, Inc. in New York, New York, United States, 10013.
Q: How much is Brigugl.io worth?
A: Brigugl.io has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Brigugl.io Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Brigugl.io Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Brigugl.io

H1 Headings

2 :
  1. Louise Briguglio
  2. Product & Design Leader, Advisor, Speaker

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Brigugl.io

0sqsslidewrapperdataslidetypecoverpagesocialiconscolorstandardsocialiconsstyleregularuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsdataslicetypesocialiconshover spotifydataslicetypetwitternotdatacompoundtypecaptchacontainerwrapperdataslicetypealbum iconwrapperlastchildmarginright0sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstylesolidsocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovereaseinout bordercolor 170mssocialiconsstylesolid dataslicetypesocialiconsdataslicetypesocialiconshover meetuphoversvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidlockstyleknockout dataslicetypelocksocialiconssizeextralargesocialiconsstyleborderuseiconfilltransparentsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons foursquareadisplayblocksqsslidewrapperdataslidetypecoverpagedataslicetypelock2sstitcherhoverdataslicetypesocialiconshover tidalhoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackedlockstyleborder dataslicetypelocksqsslidelayerlayerfrontdataslicetypesocialiconshover rdiohovericonwrapperborder2pxeaseinoutotransitionbackgroundcolor 170ms easeinouttransitionbackgroundcoloreaseinouttransitionbackgroundcolor 170msvinedataslicetypealbumhoverdataslicetypecountdown countdowncontentdataformatnumeric2s easesqsslidewrapperdataslidetypecoverpagebuttonstyleoutlinedataslicetypesocialiconshover vscodataslicetypesocialicons smugmugeaseinmoztransitionopacitydataslicetypesocialicons dribbblesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstackedinstagramhovereaseintransitionopacity 2sdataslicetypesocialicons soundcloudsqsmodallightboxcontent lightboxinneruseiconfill1ab7easqsslidewrapperdataslidetypecoverpage170ms easeinoutotransitionbackgroundcoloruseiconfillrgba0005sqsslidewrapperdataslidetypecoverpagesqsslicealbumplaylist tracks trackdataslicetypesocialicons rssbandsintownhoveractionsstackedsqsslidewrapperdataslidetypecoverpage responsivewrappernotstackedpasswordstyleunderlinedinputwrappernothiddenli ahoversqsslidewrapperdataslidetypecoverpageli2s easeinmoztransitionopacitysocialstackedtextalignleft dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstyleknockouticonwrapperwidth28pxheight28pxmargin02s easeinmstransitionopacity 2susemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleauto dataslicetypebuttonsasqsslidewrapperdataslidetypecoverpagegoodreadsdataslicetypesocialiconshover instagramhoverdataslicetypesocialiconshover mediumsqsslidewrapperdataslidetypecoverpage dataslicetypebuttonsdataslicetypebuttons ulsqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestacked inputwrappericonwrapper170ms easeinoutmoztransitionbackgroundcolor 170ms2em 0px 0pxuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypebuttons uldataslicetypesocialicons vscosvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpagesocialiconsstyleknockoutdataslicetypesocialiconshover stumbleuponhoverdataslicetypesocialiconshover smugmugsqsslicedatacontentemptytruedisplaynonesqsslidewrapperdataslidetypecoverpagedataslicetypealbum sqsslicealbumplaylistsmugmughoversqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineauto dataslicetypebuttonsdataslicetypesocialiconshover houzzsocialiconscolorstandardsocialiconsstyleborderdataslicetypesocialicons stitchermaxwidth600pxsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover vinehover170ms easeinoutspotifyhoverdataslicetypesocialiconshover emailhoveraudioplayericonsstyleborderactionsstacked inputwrappernothiddeneaseinoutotransitioncolordataslicetypesocialiconshover iconwrapperlightboxcontentdataslicetypesocialiconshover squarespacehoverflickrdataslicetypesocialiconshover ituneshoversqsslicecustomformsqsslidewrapperdataslidetypecoverpagesqssliceplaybuttoniconwrapperhover2s easeinmstransitionopacitysqsslidecontainerdataslidetypepopupoverlayoverlayloadanimationslideiniconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstyleknockoutall and maxwidth600pxsqsslidewrapperdataslidetypecoverpagedataslicetypenavigation ul liverticalpositioningmiddleiconwrapperlastchildmarginright0sqsslidewrapperdataslidetypecoverpagevideoiconstyleborderresponsivewrapperstacked dataslicetypenavigation ulsqsslicealbumplayliststackedtumblrlockstyleregular dataslicetypelocksqsslidewrapperdataslidetypecoverpage dataslicetypecountdownformwrapper inputtypesubmithoversqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover vevohover170ms easeinoutsqsslidewrapperdataslidetypecoverpagesocialiconsstyleregularcountdowncontentdataformattextualsqsslidecontainerdataslidetypepopupoverlayoverlayalignmentlefteaseinoutmoztransitionbackgroundcolor 170ms easeinoutmstransitionbackgroundcoloruseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutsqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdemoalbumusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoverdataslicetypesocialiconshover smugmughover7pxsnapchatsocialiconssizelargesocialiconsstyleknockoutbordercolorsocialiconssizelargesocialiconsstyleborderusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliduseiconfillff4500sqsslidewrapperdataslidetypecoverpage170ms easeinoutmstransitionbackgroundcolor 170mssocialiconssizeextrasmallsocialiconsstylesoliduseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoverfacebookbuttonstyleoutline datacompoundtypepopupoverlayactionsocialstacked dataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagegroupcopystackedsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenableddribbblevimeohoverreddithoverli asqsslidewrapperdataslidetypecoverpageshowtracktitle sqsalbumminimal dataslicetypealbumdataslicetypetwitter tweetavataritunesbehancedataslicetypesocialiconshover linkedinhoversqsslidecontainerdataslidetypepopupoverlay datacompoundtypepopupoverlayactiondataslicetypenavigationdataslicetypesocialiconshover emailuseiconfille4405fsqsslidewrapperdataslidetypecoverpageeaseoutopacity 170msdisplaytablesqsslidewrapperdataslidetypecoverpage4pxdataslicetypesocialiconshover facebookdataslicetypesocialiconshover githubhoversocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoversocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshoveruseiconfillae995asqsslidewrapperdataslidetypecoverpagesocialiconssizelargesocialiconsstyleregularaudioplayericonsstylesolideaseinoutotransitionbackgroundcolor 170mssqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrappernothiddentrackprogressbarsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttons li1pxresponsivewrapperwrappedsocialiconssizesmallsocialiconsstyleborderhouzz1sdisclaimercontainersqsslidewrapperdataslidetypecoverpagebuttonstyleoutline dataslicetypebuttons3pxmeetupgalleryvideobackgrounduseiconfill382110sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons tidaluseiconfill3b5998sqsslidewrapperdataslidetypecoverpagesoundcloudhoverdataslicetypealbum iconwrapperresponsivewrapperstacked dataslicetypebuttonsulsqsslidewrapperdataslidetypecoverpageactionsnotstacked inputwrappernothiddenasqsslidewrapperdataslidetypecoverpage buttonstyleoutlinedataslicetypesocialicons thedotsaudioplayericonsstyleknockoutuseiconfill8c8070sqsslidewrapperdataslidetypecoverpageuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconshoversqsslidelayercontentdataslicetypesocialiconshover stumbleupondataslicetypenavigation ulyoutubehovereaseinouteaseinoutotransitionbackgroundcolordataslicetypealbum trackprogressbardataslicetypesocialiconshover googlehoveruseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregulartwitterhoverdataslicetypesocialiconshover codepencountdowncontentdataformattextual countdownunitdataslicetypesocialicons snapchatdataslicetypesocialicons instagramrdiosocialiconssizeextralargesocialiconsstylesolidpasswordstylerectangle dataslicetypepasswordimportantsqsslidewrapperdataslidetypecoverpageeaseoutopacitybuttonshapepillsocialiconsstyleknockout dataslicetypesocialiconspinteresthoverresponsivewrapper2s easeinotransitionopacity 2sdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstyleknockoutresponsivewrapperstacked dataslicetypenavigationuseiconfille6b91esqsslidewrapperdataslidetypecoverpagesocialiconsstyleregular dataslicetypesocialiconsuseiconfillf60sqsslidewrapperdataslidetypecoverpagesmugmugsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleraiseddataslicetypesocialiconshover goodreadshoveronly screendataslicetypesocialiconshover bandsintownhoverpasswordstyleunderlined dataslicetypepassword2s easeintransitionopacity 2sformitemsqsslidewrapperdataslidetypecoverpageiconwrapperhoversvgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypecoverpageinputtypesubmithoversqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover snapchatdataslicetypesocialiconshover thedotshovericonwrapperwidth24pxheight24pxmargin0easeinoutmoztransitionbackgroundcolor 170msituneshoversnapchathoverformitemsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineuseiconfill55aceesqsslidewrapperdataslidetypecoverpagesqssliceplaybuttoniconwrappersqsslidewrapperdataslidetypecoverpage0pxdataslicetypealbum iconwrapperlastchildsqsslidewrapperdataslidetypecoverpageeaseinoutmstransitionbackgroundcolor0px 0pxsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleautodataslicetypesocialicons redditiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstylesolideaseinouttransitionbackgroundcolorlightboxinner lightboxcontentsocialiconssizeextrasmallsocialiconsstyleknockoutdataslicetypesocialiconshover dropboxhover170ms easeinoutmoztransitionbackgroundcolorsqsslidecontainerdataslidetypepopupoverlaysquarespacedataslicetypesocialicons tumblrdataslicetypesocialiconshover youtubesqsslidesqsslideanimationreadysqsslidewrapperdataslidetypecoverpage dataslicetypecountdown countdowncontentdataformatnumericsqsalbumminimal dataslicetypealbumdataslicetypesocialicons applepodcastdataslicetypemap gmnoprintsqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutline datacompoundtypepopupoverlayactioniconwrappersqsslidewrapperdataslidetypecoverpagesocialiconssizeextralargesocialiconsstyleknockoutfacebookhoveruseiconfill00b488sqsslidewrapperdataslidetypecoverpagetumblrhoveraudioplayericonsstylesolid dataslicetypealbumhovershowtracktitlebuttonsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineformwrapper puseiconfillc41200sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover twitchtrackdataslicetypesocialicons goodreadsuseiconfille52d27sqsslidewrapperdataslidetypecoverpageresponsivewrapperstacked dataslicetypebuttons uldataslicetypesocialiconshover stitcherhoverinputtypetextsqsslidewrapperdataslidetypecoverpage170ms easeoutopacity 170msgoogledatacompoundtypepopupoverlayaction inputtypetextsqsslidewrapperdataslidetypecoverpagegmstylecc170ms easeinoutotransitionbackgroundcolor 170msdataslicetypesocialiconshover facebookhoverdataslicetypegallerysqsgallerygriddataslicetypesocialiconshover twitterdataslicetypesocialicons itunesactionsstacked inputwrappersocialiconssizemediumsocialiconsstyleregulartweethandlebuttonstyleoutlinesqsmodallightboxuseiconfill4183c4sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover tidaldataslicetypesocialiconshover imdbhoveruseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconssqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled datacompoundtypepopupoverlayactiondataslicetypesocialiconshover goodreadsdataslicetypesocialiconshover behancehoverdataslicetypesocialiconshover foursquarethedotshoverrdiohoverbuttonstylesoliddataslicetypesocialiconshover tumblrlightboxinner170ms easeinouttransitionbackgroundcolor 170msdataslicetypesocialiconshover twitterhoverdataslicetypesocialiconshover dropboxcountdownunitdataslicetypesocialiconshover applepodcasthoverdataslicetypealbum tracktitlegalleryvideobackgroundmobiledataslicetypesocialiconshover linkedinfivehundredpixdataslicetypesocialicons vimeoiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstyleknockouteaseinoutsqsslidewrapperdataslidetypecoverpage socialiconsstylesolidsocialiconsstylesolid dataslicetypesocialiconshoverdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstylesolidneuearialsansseriffontweightnormalfontstylenormalletterspacing6pxsqsslidewrapperdataslidetypecoverpagegoodreadshovercodepenhoverinputtypesubmitsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover stitcherlightboxcontent formwrapper puseiconfill000sqsslidewrapperdataslidetypecoverpagetracktitleyelpsqsslidecontainerdataslidetypepopupoverlayoverlayalignmentcenterdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstyleknockoutdataslicetypesocialiconshover flickrarrowiconeaseinotransitionopacity 2sinputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutline datacompoundtypepopupoverlayactiondataslicetypesocialicons googleplaydataslicetypelock usebackgroundfilltransparentsqsslidewrapperdataslidetypecoverpageimportantsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstylesoliddesign170ms easeoutopacitysocialiconssizemediumsocialiconsstyleborderdataslicetypesocialicons twitteruseiconfill0099e5sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover rdiouseiconfill7dbb00sqsslidewrapperdataslidetypecoverpageuseiconfill7ac143sqsslidewrapperdataslidetypecoverpagedataslicetypebuttons li ahoversqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover vimeohoversocialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsdataslicetypealbumdataslicetypesocialiconshover behancesqsslicealbumplaylistdemoalbumdataslicetypesocialiconshover squarespacevideoiconstylesoliddataslicetypesocialiconshover tumblrhover8pxgoogleplayhoversocialiconssizesmallsocialiconsstyleregularul lidataslicetypecountdown countdowncontentdataformattextualimdbdataslicetypebuttons asqsslidewrapperdataslidetypecoverpagepasswordstylerectangleinputtypepasswordsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconssqsslidecontainerdataslidetypepopupoverlay captchacontainerwrappersqsslidecontainernotautoimagebackgroundcolorlinkedinhoverp ahoversqsslidewrapperdataslidetypecoverpageiconwrapperdivwebkittransformscale2moztransformscale2mstransformscale2transformscale2sqsslidewrapperdataslidetypecoverpagesvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstylestackedyelphoversocialiconscolorstandardsocialiconsstyleknockoutlisqsslidewrapperdataslidetypecoverpagevevodataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaybuttonstyleoutlinesocialiconssizeextrasmallsocialiconsstyleborderdataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstyleknockoutusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockoutsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliduseiconfill007ee5sqsslidewrapperdataslidetypecoverpagedataslicetypepassword arrowicondataslicetypesocialicons rdioinstagramuseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsahoversqsslidewrapperdataslidetypecoverpage2s 2ssocialiconssizemediumsocialiconsstylesolideaseinoutmstransitioncolorautoflex1dataslicetypebuttonssqsslidewrapperdataslidetypecoverpage1useiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshoverformwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutlineerrormessagesqsslidewrapperdataslidetypecoverpagesocialiconssizesmallsocialiconsstylesolidfielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25emdataslicetypebuttons lisqsslidewrapperdataslidetypecoverpageaudioplayericonsstyleregulardataslicetypealbum sqsslicealbumplaylistdemoalbumeaseinouttransitionbackgroundcolor 170ms easeinoutsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover fivehundredpixhoversqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangle6pxasqsslidewrapperdataslidetypecoverpage buttonstyleoutline sqsslicecustomformdataslicetypesocialiconshover reddithoverspotifydataslicetypesocialicons codepentweetbodyfoursquaredataslicetypesocialiconshover yelpbandsintowndropboxhoveruseiconfillfffsqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolidsqsslidecontainerdataslidetypepopupoverlaynewsletterstylerectangle datacompoundtypepopupoverlayactiondataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstylesolid0ms 0mseaseinmstransitionopacitysqsslidecontainerdataslidetypepopupoverlaynewsletterstyleoutlinedataslicetypesocialiconshover bandsintowneaseinoutsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons squarespacesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsnotstacked inputwrappernothiddenp asqsslidewrapperdataslidetypecoverpagemediumhoversocialiconsstyleborder dataslicetypesocialiconsscreenstumbleuponsqsslicealbumplaylistbordercolor 170ms easeinoutsqsslidewrapperdataslidetypecoverpage2em 0pxdataslicetypesocialicons houzzlockstylesolid dataslicetypelocktwitchsoliddataslicetypesocialiconshover soundcloudhoversocialiconsstylesolid dataslicetypesocialiconshover iconwrapperhoverdataslicetypesocialiconshoversvgsocialwebkittransitionbackgroundcolor 170ms easeinoutmoztransitionbackgroundcoloreasesqsslidewrapperdataslidetypecoverpagesvgsocialbackgroundcolorrgba3434344sqsslidewrapperdataslidetypecoverpagedataslicetypealbumhover iconwrapperdataslicetypesocialicons githubdataslicetypebuttons libuttonstyleoutlinesqsmodallightbox formwrappercodependataslicetypetwittericonwrapperlastchildsqsslidewrapperdataslidetypecoverpageasqsslidewrapperdataslidetypecoverpage dataslicetypetwitterlockstyleborderusebackgroundfilltransparentsqsslidewrapperdataslidetypecoverpagebehancehovertidaldataslicetypesocialiconshover githubtweetdisplaynamehouzzhoverdataslicetypesocialiconshover twitchhoveruseiconfilleb4924sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover vscohoverdataslicetypesocialicons vinedataslicetypebuttons ul lisqsslidewrapperdataslidetypecoverpageiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextralargesocialiconsstylesolidbuttonstyleraiseddataslicetypesocialicons imdbusemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconssqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlinesqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlinedataslicetypesocialicons twitchdribbblehoveruseiconfill0063dcsqsslidewrapperdataslidetypecoverpageuseiconfillrgba3434344sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons bandsintowndataslicetypesocialiconshover pinterestsqsmodallightboxeaseinoutmoztransitioncolorusemaskfillrgba3434344sqsslidewrapperdataslidetypecoverpagesoundcloudeaseintransitionopacitysqsmodallightboxcontent lightboxinner lightboxcontentvscohovergmnoprinteaseinmstransitionopacity 2stwitchhover170ms easeinoutmstransitionbackgroundcolortidalhoversquarespacehoverdataslicetypebuttons ahoversqsslidewrapperdataslidetypecoverpagesocialiconsstylesolidtweettimestampsqsalbumminimaldataslicetypesocialiconshover spotifyhoversqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinline dataslicetypebuttons0 0sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover rsshoverlightboxcontent formwrapperuseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesoliddataslicetypesocialicons linkedinuseiconfille0393esqsslidewrapperdataslidetypecoverpagemediumsqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline dataslicetypebuttonsneuearialsansseriffontsize16pxtexttransformnoneletterspacing03emfontweightnormalfontstylenormalsqsslidewrapperdataslidetypecoverpagegithub2s easeinmoztransitionopacity 2siconwrapperwidth36pxheight36pxmargin0linkedinuseiconfill1ea9e1sqsslidewrapperdataslidetypecoverpagegithubhoverformwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons emailusemaskfilltransparentsqsslidewrapperdataslidetypecoverpageapplepodcastdataslicetypesocialiconshover foursquarehovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstyleknockoutemaildataslicetypebuttons li asqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover google2emsqsslicealbumplaylist tracksdatacompoundtypepopupoverlayactiondataslicetypesocialiconshover redditimdbhovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizelargesocialiconsstylesolidsvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconshovertweetavatarneuearialsansseriffontsize15pxlineheight14emtexttransformnoneletterspacing03emfontweightnormalfontstylenormalcolorrgba00061sqsslidewrapperdataslidetypecoverpagedataslicetypetwitternotdatacompoundtype tweettimestamp01susemaskfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconshovervideoiconstyleknockoutspansqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover mediumhoveruseiconfill6441a5sqsslidewrapperdataslidetypecoverpage0dataslicetypemap gmstyleccbuttonplaypausebuttonshaperoundedcornersdataslicetypesocialicons svgsocialbackgroundcolortransparentsqsslidewrapperdataslidetypecoverpagesqsslicecustomform spansqsslidewrapperdataslidetypecoverpageaudioplayericonsstyleregular dataslicetypealbumshowtracktitle sqsalbumminimal14pxdataslicetypesocialiconshover dribbblehoversocialiconssizeextralargesocialiconsstyleregularuseiconfill006ed2sqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover vinedataslicetypealbum iconwrappersqsslidewrapperdataslidetypecoverpagesvgsocialwebkittransitionbackgroundcolor 170msdataslicetypesocialiconshover houzzhoverbuttonstyleoutline sqsslicecustomformsocialiconscolorstandardsocialiconsstyleknockout dataslicetypesocialiconsinputtypepasswordmozplaceholdercolorfffsqsslidewrapperdataslidetypecoverpage0msdataslicetypesocialicons meetupsocialstackedtextalignleft170msautosqsslidewrapperdataslidetypecoverpageactionssqsslidewrapperdataslidetypecoverpageeaseinoutmoztransitionbackgroundcolorulstacked5pxuseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstylebordersqsslicecustomform asqsslidewrapperdataslidetypecoverpagedataslicetypealbumhover iconwrapperhoversvgsocialwebkittransitionbackgroundcolordataslicetypesocialiconshover codepenhovertwitterdataslicetypesocialiconshover vevodataslicetypesocialicons vevo100msdataslicetypesocialiconshover rssdataslicetypegallery galleryvideobackgroundmobiledataslicetypesocialiconshover youtubehoveruseiconfill0976b4sqsslidewrapperdataslidetypecoverpagedataslicetypetwitternotdatacompoundtype tweetbodyusemaskfill222sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons mediumbuttonsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstackeddataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstylesolidbuttontypesubmitsqsslidewrapperdataslidetypecoverpagesvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregular dataslicetypesocialiconsdataslicetypealbum sqsslicealbumplaylistplayingdataslicetypealbum sqsslicealbumplayliststackedlightboxinner lightboxcontent formwrappersqsmodallightboxcontentuseiconfillff0031sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons spotifygoogleplayuseiconfillrgba2552552554sqsslidewrapperdataslidetypecoverpageformwrapperdataslicetypepasswordinputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypecoverpagedataslicetypecountdowndataslicetypesocialicons googledataslicetypesocialicons fivehundredpixdatacompoundtypepopupoverlayaction errormessagesqsslidewrapperdataslidetypecoverpagesqsalbumminimal dataslicetypealbum sqsslicealbumplayliststackeduseiconfillf94877sqsslidewrapperdataslidetypecoverpagepsqsslicecustomform ahoversqsslidewrapperdataslidetypecoverpageiconwrapperwidth32pxheight32pxmargin0dataslicetypesocialiconshover imdbsocialiconscolorstandardsocialiconsstylesoliddataslicetypesocialicons dropboxmapstyleminimaldarksvgsocialbackgroundcolor222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregulardataslicetypesocialicons usemaskfilltransparentsqsslidewrapperdataslidetypecoverpagevimeosocialiconssizemediumsocialiconsstyleknockoutdropboxinputwrapperresponsivewrapperstackedtextaligncenterdataslicetypesocialiconshover flickrhoverbordercolor 170ms170ms easeinout bordercolorresponsivewrapperstacked sqsslicecustomformsocialiconscolorstandardsocialiconsstylesolid dataslicetypesocialiconsdataslicetypebuttons ul lidataslicetypesocialiconshover googleplaydataslicetypesocialiconshover dribbbleeaseinotransitionopacityuseiconfill00ab6csqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlined datacompoundtypepopupoverlayactiondataslicetypealbum sqsslicealbumplaylist tracksuseiconfill35465dsqsslidewrapperdataslidetypecoverpagesqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebodysqsslicealbumplaylistplayingbuttonstyleoutlinesqsmodallightbox formwrapper inputtypesubmitsqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons youtubeavisitedsqsslidewrapperdataslidetypecoverpageinputtypetextsqsslidewrapperdataslidetypecoverpage sqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinlineuseiconfilldc4e41sqsslidewrapperdataslidetypecoverpagepinterestreddituseiconfill5adfcbsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover vimeoeaseinmoztransitionopacity 2ssqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutline datacompoundtypepopupoverlayactionactionsnotstackediconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizemediumsocialiconsstyleknockoutaudioplayericonsstyleborder dataslicetypealbuminputtypesubmitsqsslidewrapperdataslidetypecoverpage buttonstyleoutlinersshovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstyleknockout170ms easeinouttransitionbackgroundcoloruseiconfill222sqsslidewrapperdataslidetypecoverpagescreen and maxwidth600pxsqsslidewrapperdataslidetypecoverpageeaseinout bordercolordataslicetypepassword inputtypepasswordsqsslidewrapperdataslidetypecoverpageyoutubeuseiconfill84bd00sqsslidewrapperdataslidetypecoverpagedataslicetypemapsqssliceplaybuttoniconwrapperuseiconfillcc2127sqsslidewrapperdataslidetypecoverpagedataslicetypesocialicons iconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstyleknockoutlockstylesoliddataslicetypesocialiconshover applepodcastdataslicetypesocialiconshover yelphoversqsslidecontainerdataslidetypepopupoverlaynewsletterlayoutstyleinline actionsstacked inputwrapperlockstyleknockoutvevohoverdataslicetypesocialicons yelptracks trackdataslicetypesocialicons facebookbuttonsqsslidewrapperdataslidetypecoverpagesqsslicecustomformsqsslidecontainerdataslidetypepopupoverlaybuttonlayoutstyleinlineautodataslicetypesocialiconshover snapchathoverdataslicetypesocialiconshover instagramdatacompoundtypepopupoverlayaction inputtypetextmozplaceholdercolorrgba1631631635sqsslidewrapperdataslidetypecoverpagesqsmodallightboxopeneaseinoutmstransitionbackgroundcolor 170ms easeinoutotransitionbackgroundcolordataslicetypebuttons ulstackedvscotracksemailhovericonwrappersqsslidewrapperdataslidetypecoverpage socialiconssizesmallsocialiconsstylesoliddataslicetypesocialiconshover googleplayhovereaseinoutmstransitionbackgroundcolor 170msdataslicetypebuttonsdataslicetypesocialicons behanceeaseinouttransitioncoloruseiconfillfffsqsslidewrapperdataslidetypecoverpage2s easeinotransitionopacitydataslicetypepassword inputtypepasswordmozplaceholdercolorfffsqsslidewrapperdataslidetypecoverpagefielderrordisplayblockpositionabsoluteboxsizingborderboxpadding25em 5emfont14pxallsocialiconssizesmallsocialiconsstyleknockoutdataslicetypeheadingnotdatacompoundtypeusebackgroundfillfffsqsslidewrapperdataslidetypecoverpagecountdowncontentdataformatnumericul li asqsslidewrapperdataslidetypecoverpageapplepodcasthoverfoursquarehoveruseiconfill1769ffsqsslidewrapperdataslidetypecoverpagesqsslidewrapperdataslidetypecoverpagesocialstackedtextalignleft dataslicetypesocialiconsuseiconfillfffbackgroundcolorfffsqsslidewrapperdataslidetypecoverpagedataslicetypesocialiconshover thedotsdataslicetypecountdown countdowncontentdataformattextual countdownunitdataslicetypesocialiconshover pinteresthoverimportantsqsslidewrapperdataslidetypecoverpage sqsslidecontainernotautoimagebackgroundcoloruseiconfill222sqsslidewrapperdataslidetypecoverpage socialiconscolorstandardsocialiconsstyleregulardataslicetypesocialiconshover soundcloudvideoiconstyleregularthedotsdataslicetypebodyvinehoverdataslicetypesocialiconshover meetupsocialiconssizelargesocialiconsstylesolidsocialiconscolorstandardsocialiconsstyleborder dataslicetypesocialiconsdataslicetypegallery galleryvideobackgroundiconwrappersqsslidewrapperdataslidetypecoverpage socialiconssizeextrasmallsocialiconsstylesolidresponsivewrapperstackedsqsslidecontainerdataslidetypepopupoverlayenableoverlaycontentborderdatacompoundtypepopupoverlayaction buttontypesubmitsqsslidewrapperdataslidetypecoverpagestitcherdataslicetypegallerysqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabledbuttonstyleoutlinedataslicetypesocialiconshover fivehundredpixdataslicetypebody puseiconfill00b4b3sqsslidewrapperdataslidetypecoverpageuseiconfillea4c89sqsslidewrapperdataslidetypecoverpageonlystumbleuponhoverdataslicetypesocialiconshover iconwrapperhoverfivehundredpixhoverul lisqsslidewrapperdataslidetypecoverpagesocialiconsstylesolid dataslicetypesocialiconshover iconwrapperresponsivewrappernotstackedsocialiconsstylebordersqsslidecontainerdataslidetypepopupoverlayoverlaymobilestylesenabled dataslicetypebody puseiconfillec4652sqsslidewrapperdataslidetypecoverpage2s easeintransitionopacitydataslicetypesocialicons stumbleuponsqsalbumminimal dataslicetypealbum sqsslicealbumplaylistdataslicetypesocialicons flickrgooglehoversqsslidecontainerdataslidetypepopupoverlaynewsletterstyleunderlinedsocialstacked10pxdataslicetypesocialicons pinterestsocialiconssizeextrasmallsocialiconsstyleregularsocialstacked dataslicetypesocialiconslockstyleregulardataslicetypesocialiconshover itunesmeetuphoverrssul5emfont14pxflickrhover

Longtail Keyword Density for Brigugl.io

KeywordsOccurences
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
sqs-modal-lightbox-content lightbox-inner lightbox-content19
ease-in-out border-color 170ms15
170ms ease-in-out border-color15
lightbox-inner lightbox-content form-wrapper14
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlist14
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons12
data-slice-typealbum sqs-slice-album-playlist tracks11
socialstacked data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
socialstackedtext-align-left data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
170ms ease-in-out-moz-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color 170ms8
170ms ease-in-out-o-transitionbackground-color 170ms8
170ms ease-in-outtransitionbackground-color 170ms8
sqs-slice-album-playlist tracks track7
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons6
show-track-title sqs-album-minimal data-slice-typealbum6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
2em 0px 0px6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
ease-in-outtransitionbackground-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover6
ease-in-out-moz-transitionbackground-color 170ms ease-in-out-ms-transitionbackground-color6
ease-in-out-ms-transitionbackground-color 170ms ease-in-out-o-transitionbackground-color6
ease-in-out-o-transitionbackground-color 170ms ease-in-outtransitionbackground-color6
data-slice-typebuttons li asqs-slide-wrapperdata-slide-typecover-page5
data-slice-typenavigation ul li5
170ms ease-outopacity 170ms5
svgsocial-webkit-transitionbackground-color 170ms ease-in-out-moz-transitionbackground-color4
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked input-wrappernothidden4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody p4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons li4
data-slice-typebuttons ul lisqs-slide-wrapperdata-slide-typecover-page4
data-slice-typebuttons ul li4
lightbox-content form-wrapper p4
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapperhover4
responsive-wrapperstacked data-slice-typenavigation ul4
responsive-wrapperstacked data-slice-typebuttons ul3
sqs-slide-wrapperdata-slide-typecover-page data-slice-typecountdown countdown-contentdata-formatnumeric3
data-slice-typecountdown countdown-contentdata-formattextual countdown-unit3
button-style-outlinesqs-modal-lightbox form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page3
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline3
social-icons-style-solid data-slice-typesocial-iconshover icon-wrapper3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrapper3
buttonsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked3
data-slice-typebuttons li ahoversqs-slide-wrapperdata-slide-typecover-page3
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline data-compound-typepopup-overlay-action3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-solid3
screen and max-width600pxsqs-slide-wrapperdata-slide-typecover-page3
ul li asqs-slide-wrapperdata-slide-typecover-page3
2s ease-in-moz-transitionopacity 2s3
2s ease-in-ms-transitionopacity 2s3
2s ease-in-o-transitionopacity 2s3
2s ease-intransitionopacity 2s3
border-color 170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playlistdemo-album3
sqs-album-minimal data-slice-typealbum sqs-slice-album-playliststacked3
asqs-slide-wrapperdata-slide-typecover-page button-style-outline sqs-slice-custom-form3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-knockout3
all and max-width600pxsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-solid3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-knockout3
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-solid3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked input-wrappernothidden3
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-iconshover176
social-icons-color-standardsocial-icons-style-border data-slice-typesocial-icons176
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-iconshover88
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid88
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-iconshover88
social-icons-color-standardsocial-icons-style-solid data-slice-typesocial-icons88
social-icons-color-standardsocial-icons-style-knockout data-slice-typesocial-icons44
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid44
social-icons-color-standardsocial-icons-style-regular data-slice-typesocial-icons44
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout44
data-slice-typesocial-icons icon-wrappersqs-slide-wrapperdata-slide-typecover-page34
sqs-album-minimal data-slice-typealbum25
sqs-modal-lightbox-content lightbox-inner21
socialstacked data-slice-typesocial-icons20
socialstackedtext-align-left data-slice-typesocial-icons20
lightbox-inner lightbox-content19
data-slice-typecountdown countdown-contentdata-formatnumeric18
data-slice-typealbum sqs-slice-album-playlist15
border-color 170ms15
ease-in-out border-color15
170ms ease-in-out15
lightbox-content form-wrapper14
data-slice-typegallery gallery-video-background14
170ms ease-in-outsqs-slide-wrapperdata-slide-typecover-page13
sqs-slide-containerdata-slide-typepopup-overlay data-compound-typepopup-overlay-action12
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-border12
data-slice-typebuttons ul12
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsnotstacked12
data-slice-typealbum icon-wrapper11
data-slice-typecountdown countdown-contentdata-formattextual11
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline actionsstacked11
0 0sqs-slide-wrapperdata-slide-typecover-page11
sqs-slice-album-playlist tracks11
data-slice-typealbum icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typecover-page10
data-slice-typealbum icon-wrappersqs-slide-wrapperdata-slide-typecover-page10
password-style-underlined data-slice-typepassword10
data-slice-typebuttons li10
data-slice-typenavigation ul10
data-slice-typealbum icon-wrapperlast-childsqs-slide-wrapperdata-slide-typecover-page10
password-style-rectangle data-slice-typepassword9
ul li9
data-slice-typebody p8
social-icons-style-solid data-slice-typesocial-iconshover8
170ms ease-in-outtransitionbackground-color8
170ms ease-in-out-o-transitionbackground-color8
ease-in-out-ms-transitionbackground-color 170ms8
li asqs-slide-wrapperdata-slide-typecover-page8
data-slice-typebuttons asqs-slide-wrapperdata-slide-typecover-page8
ease-in-outtransitionbackground-color 170ms8
170ms ease-in-out-moz-transitionbackground-color8
ease-in-out-moz-transitionbackground-color 170ms8
170ms ease-in-out-ms-transitionbackground-color8
ease-in-out-o-transitionbackground-color 170ms8
social-icons-style-border data-slice-typesocial-icons7
sqs-slice-custom-form asqs-slide-wrapperdata-slide-typecover-page7
button-style-outline data-compound-typepopup-overlay-action7
show-track-title sqs-album-minimal7
button-style-outlinesqs-modal-lightbox form-wrapper7
tracks track7
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-regular6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-knockout6
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page social-icons-color-standardsocial-icons-style-solid6
data-slice-typesocial-iconshover icon-wrapperhover6
button-style-outline sqs-slice-custom-form6
data-slice-typealbum track-progress-bar6
data-slice-typebuttons ulsqs-slide-wrapperdata-slide-typecover-page6
form-wrapper inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page6
2em 0px6
0px 0px6
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-compound-typepopup-overlay-action6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline data-compound-typepopup-overlay-action6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle data-compound-typepopup-overlay-action6
audio-player-icons-style-border data-slice-typealbum6
button-style-outline data-slice-typebuttons6
data-slice-typesocial-icons fivehundredpix5
data-slice-typesocial-icons twitter5
data-slice-typesocial-icons stitcher5
data-slice-typesocial-icons goodreads5
data-slice-typesocial-icons email5
data-slice-typesocial-icons facebook5
data-slice-typesocial-icons instagram5
data-slice-typesocial-icons google5
data-slice-typesocial-icons dropbox5
data-slice-typesocial-icons codepen5
data-slice-typesocial-icons github5
data-slice-typesocial-icons stumbleupon5
responsive-wrapperstacked data-slice-typebuttons5
data-slice-typesocial-icons spotify5
data-slice-typesocial-icons twitch5
data-slice-typesocial-icons foursquare5
data-slice-typesocial-icons imdb5
data-slice-typesocial-icons houzz5
data-slice-typesocial-icons tumblr5
data-slice-typesocial-icons tidal5
data-slice-typesocial-icons thedots5
data-slice-typesocial-icons flickr5
data-slice-typesocial-icons behance5
data-slice-typesocial-icons dribbble5
data-slice-typesocial-icons soundcloud5
data-slice-typesocial-icons itunes5
data-slice-typesocial-icons rdio5
data-slice-typesocial-icons vevo5
data-slice-typesocial-iconshover icon-wrapper5
data-slice-typesocial-icons youtube5
asqs-slide-wrapperdata-slide-typecover-page button-style-outline5
data-slice-typesocial-icons rss5
data-slice-typesocial-icons pinterest5
sqs-slide-wrapperdata-slide-typecover-page data-slice-typebuttons5
0ms 0ms5
data-slice-typealbum sqs-slice-album-playlistplaying5
data-slice-typesocial-icons googleplay5
2s 2s5
170ms ease-outopacity5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined data-compound-typepopup-overlay-action5
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled data-slice-typebody5
ease-outopacity 170ms5
ul lisqs-slide-wrapperdata-slide-typecover-page5
responsive-wrapperstacked data-slice-typenavigation5
data-slice-typesocial-icons snapchat5
data-slice-typesocial-icons squarespace5
data-slice-typesocial-icons meetup5
data-slice-typesocial-icons medium5
data-slice-typesocial-icons bandsintown5
data-slice-typesocial-icons linkedin5
data-slice-typesocial-icons vimeo5
data-slice-typesocial-icons applepodcast5
data-slice-typesocial-icons reddit5
data-slice-typesocial-icons vine5
data-slice-typesocial-icons vsco5
lock-style-regular data-slice-typelock5
data-slice-typesocial-icons smugmug5
data-slice-typesocial-icons yelp5
data-slice-typesocial-iconshover reddithover4
data-slice-typesocial-iconshover smugmug4
data-slice-typesocial-iconshover spotify4
data-slice-typesocial-iconshover rss4
data-slice-typesocial-iconshover smugmughover4
data-slice-typesocial-iconshover reddit4
data-slice-typesocial-iconshover snapchathover4
data-slice-typesocial-iconshover soundcloudhover4
data-slice-typesocial-iconshover spotifyhover4
data-slice-typesocial-iconshover rsshover4
data-slice-typesocial-iconshover snapchat4
data-slice-typesocial-iconshover soundcloud4
data-slice-typesocial-iconshover googlehover4
data-slice-typesocial-iconshover squarespace4
data-slice-typesocial-iconshover vevo4
form-wrapper p4
audio-player-icons-style-solid data-slice-typealbumhover4
data-slice-typesocial-iconshover youtubehover4
data-slice-typesocial-iconshover youtube4
data-slice-typesocial-iconshover yelphover4
data-slice-typesocial-iconshover yelp4
data-slice-typesocial-iconshover vscohover4
data-slice-typesocial-iconshover vsco4
data-slice-typesocial-iconshover vinehover4
data-slice-typesocial-iconshover vine4
data-slice-typesocial-iconshover vimeohover4
data-slice-typesocial-iconshover vevohover4
data-slice-typesocial-iconshover twitterhover4
data-slice-typesocial-iconshover squarespacehover4
data-slice-typesocial-iconshover twitter4
data-slice-typesocial-iconshover twitchhover4
data-slice-typesocial-iconshover twitch4
data-slice-typesocial-iconshover tumblrhover4
data-slice-typesocial-iconshover tumblr4
data-slice-typesocial-iconshover tidalhover4
data-slice-typesocial-iconshover tidal4
data-slice-typesocial-iconshover thedotshover4
data-slice-typesocial-iconshover thedots4
data-slice-typesocial-iconshover stumbleuponhover4
data-slice-typesocial-iconshover stumbleupon4
data-slice-typesocial-iconshover stitcherhover4
data-slice-typesocial-iconshover stitcher4
data-slice-typesocial-iconshover vimeo4
data-slice-typesocial-iconshover emailhover4
data-slice-typesocial-iconshover rdiohover4
social-icons-style-regular data-slice-typesocial-icons4
data-slice-typesocial-iconshover dropboxhover4
data-slice-typesocial-iconshover dropbox4
data-slice-typesocial-iconshover dribbblehover4
data-slice-typesocial-iconshover dribbble4
data-slice-typesocial-iconshover codepenhover4
data-slice-typesocial-iconshover rdio4
data-slice-typesocial-iconshover behancehover4
data-slice-typesocial-iconshover behance4
data-slice-typesocial-iconshover bandsintownhover4
data-slice-typesocial-iconshover bandsintown4
data-slice-typesocial-iconshover applepodcasthover4
data-slice-typesocial-iconshover applepodcast4
data-slice-typealbumhover icon-wrapper4
data-slice-typesocial-iconshover facebook4
data-slice-typealbumhover icon-wrapperhover4
data-slice-typetwitternotdata-compound-type tweet-body4
lock-style-border data-slice-typelock4
data-slice-typepassword inputtypepassword-moz-placeholdercolorfffsqs-slide-wrapperdata-slide-typecover-page4
actionsnotstacked input-wrappernothidden4
data-slice-typebuttons lisqs-slide-wrapperdata-slide-typecover-page4
buttonsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline4
svgsocial-webkit-transitionbackground-color 170ms4
data-compound-typepopup-overlay-action inputtypetextsqs-slide-wrapperdata-slide-typecover-page4
data-compound-typepopup-overlay-action inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typecover-page4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-slice-typebuttons4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline data-compound-typepopup-overlay-action4
responsive-wrapperstacked sqs-slice-custom-form4
data-slice-typesocial-iconshover email4
data-slice-typesocial-iconshover codepen4
data-slice-typesocial-iconshover facebookhover4
data-slice-typesocial-iconshover houzzhover4
data-slice-typesocial-iconshover medium4
data-slice-typesocial-iconshover mediumhover4
data-slice-typesocial-iconshover linkedin4
data-slice-typesocial-iconshover meetup4
data-slice-typesocial-iconshover ituneshover4
data-slice-typesocial-iconshover meetuphover4
data-slice-typesocial-iconshover itunes4
data-slice-typesocial-iconshover fivehundredpix4
data-slice-typesocial-iconshover instagramhover4
data-slice-typesocial-iconshover pinterest4
data-slice-typesocial-iconshover instagram4
data-slice-typesocial-iconshover imdbhover4
data-slice-typesocial-iconshover imdb4
data-slice-typesocial-iconshover houzz4
data-slice-typesocial-iconshover google4
data-slice-typesocial-iconshover pinteresthover4
data-slice-typesocial-iconshover fivehundredpixhover4
data-slice-typesocial-iconshover flickr4
data-slice-typesocial-iconshover flickrhover4
data-slice-typesocial-iconshover foursquare4
data-slice-typesocial-iconshover foursquarehover4
data-slice-typesocial-iconshover github4
data-slice-typesocial-iconshover githubhover4
data-slice-typesocial-iconshover goodreads4
data-slice-typesocial-iconshover goodreadshover4
data-slice-typesocial-iconshover googleplay4
data-slice-typesocial-iconshover googleplayhover4
data-slice-typesocial-iconshover linkedinhover4
data-slice-typesocial-icons svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typesocial-icons use-maskfilltransparentsqs-slide-wrapperdata-slide-typecover-page3
li ahoversqs-slide-wrapperdata-slide-typecover-page3
social-icons-style-knockout data-slice-typesocial-icons3
social-icons-style-solid data-slice-typesocial-icons3
lock-style-solid data-slice-typelock3
data-compound-typepopup-overlay-action error-messagesqs-slide-wrapperdata-slide-typecover-page3
inputtypetextsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
actionsstacked input-wrapper3
form-itemsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked input-wrapper3
importantsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em 5emfont14px3
sqs-slide-containerdata-slide-typepopup-overlay captcha-container-wrapper3
lock-style-knockout data-slice-typelock3
data-slice-typelock use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typecover-page3
data-slice-typetwitternotdata-compound-type tweet-timestamp3
sqs-slice-custom-form ahoversqs-slide-wrapperdata-slide-typecover-page3
form-wrapper inputtypesubmithoversqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-wrapperdata-slide-typecover-page responsive-wrappernotstacked3
data-slice-typebuttons ahoversqs-slide-wrapperdata-slide-typecover-page3
audio-player-icons-style-regular data-slice-typealbum3
sqs-slice-custom-form spansqs-slide-wrapperdata-slide-typecover-page3
data-slice-typebuttons ulstacked3
data-slice-typemap gmnoprint3
data-slice-typemap gm-style-cc3
only screen3
data-slice-typealbum sqs-slice-album-playliststacked3
data-slice-typealbum sqs-slice-album-playlistdemo-album3
data-slice-typealbum track-title3
data-slice-typegallery gallery-video-backgroundmobile3
data-slice-typetwitter tweet-avatar3
ease-intransitionopacity 2s3
2s ease-intransitionopacity3
ease-in-o-transitionopacity 2s3
2s ease-in-o-transitionopacity3
ease-in-ms-transitionopacity 2s3
2s ease-in-ms-transitionopacity3
ease-in-moz-transitionopacity 2s3
2s ease-in-moz-transitionopacity3
importantsqs-slide-wrapperdata-slide-typecover-page sqs-slide-containernotauto-image-background-color3
data-compound-typepopup-overlay-action buttontypesubmitsqs-slide-wrapperdata-slide-typecover-page3
asqs-slide-wrapperdata-slide-typecover-page data-slice-typetwitter3
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page button-style-outline3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-knockout3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto data-slice-typebuttons3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto data-slice-typebuttons3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline data-slice-typebuttons3
countdown-contentdata-formattextual countdown-unit3
sqs-slide-wrapperdata-slide-typecover-page data-slice-typecountdown3
p ahoversqs-slide-wrapperdata-slide-typecover-page3
p asqs-slide-wrapperdata-slide-typecover-page3
ease-in-outsqs-slide-wrapperdata-slide-typecover-page social-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-largesocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-solid3
data-slice-typepassword inputtypepasswordsqs-slide-wrapperdata-slide-typecover-page3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-largesocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-mediumsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-smallsocial-icons-style-knockout3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-solid3
icon-wrappersqs-slide-wrapperdata-slide-typecover-page social-icons-size-extra-smallsocial-icons-style-knockout3
data-slice-typepassword arrow-icon3
2s easesqs-slide-wrapperdata-slide-typecover-page3
actionsstacked input-wrappernothidden3
data-slice-typesocial-icons440
data-slice-typesocial-iconshover364
social-icons-color-standardsocial-icons-style-solid264
social-icons-color-standardsocial-icons-style-border176
use-iconfillfffsqs-slide-wrapperdata-slide-typecover-page137
social-icons-color-standardsocial-icons-style-regular132
social-icons-color-standardsocial-icons-style-knockout132
data-slice-typealbum109
170ms90
data-compound-typepopup-overlay-action60
data-slice-typebuttons59
sqs-slide-containerdata-slide-typepopup-overlay54
icon-wrappersqs-slide-wrapperdata-slide-typecover-page46
use-iconfillrgba2552552554sqs-slide-wrapperdata-slide-typecover-page44
2s41
asqs-slide-wrapperdata-slide-typecover-page38
importantsqs-slide-wrapperdata-slide-typecover-page36
data-slice-typecountdown35
data-slice-typegallery33
data-slice-typelock30
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-inline29
data-slice-typepassword29
form-wrapper28
sqs-album-minimal27
1s25
0sqs-slide-wrapperdata-slide-typecover-page24
sqs-modal-lightbox-content24
use-iconfill222sqs-slide-wrapperdata-slide-typecover-page24
sqs-slice-custom-form24
icon-wrapper23
responsive-wrapperstacked23
lightbox-inner22
ul22
sqs-slide-wrapperdata-slide-typecover-page20
socialstackedtext-align-left20
li20
socialstacked20
020
lightbox-content19
button-style-outline19
countdown-contentdata-formatnumeric18
sqs-slice-album-playlist17
ease-in-outsqs-slide-wrapperdata-slide-typecover-page17
data-slice-typenavigation17
tracks16
data-slice-typebody16
border-color15
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabled15
ease-in-out15
gallery-video-background14
p13
sqs-modal-lightbox-open13
ahoversqs-slide-wrapperdata-slide-typecover-page13
icon-wrapperhover12
actionsnotstacked12
social-icons-style-solid12
svgsocialbackground-color222sqs-slide-wrapperdata-slide-typecover-page12
use-maskfill222sqs-slide-wrapperdata-slide-typecover-page12
0px12
countdown-contentdata-formattextual11
actionsstacked11
password-style-rectangle11
data-slice-typetwitter11
password-style-underlined11
email10
sqs-slice-play-buttonicon-wrappersqs-slide-wrapperdata-slide-typecover-page10
squarespace10
icon-wrapperlast-childmargin-right0sqs-slide-wrapperdata-slide-typecover-page10
lisqs-slide-wrapperdata-slide-typecover-page10
data-slice-typetwitternotdata-compound-type10
110
solid10
0ms10
icon-wrapperlast-childsqs-slide-wrapperdata-slide-typecover-page10
vimeo9
thedots9
tidal9
tumblr9
twitch9
twitter9
vevo9
pinterest9
codepen9
behance9
stumbleupon9
vine9
vsco9
yelp9
youtube9
applepodcast9
bandsintown9
stitcher9
meetup9
googleplay9
rdio9
reddit9
medium9
linkedin9
itunes9
instagram9
imdb9
houzz9
google9
goodreads9
soundcloud9
rss9
foursquare9
flickr9
fivehundredpix9
facebook9
smugmug9
snapchat9
dropbox9
dribbble9
spotify9
github9
max-width600pxsqs-slide-wrapperdata-slide-typecover-page9
ease-in-out-moz-transitionbackground-color9
ease-in-out-ms-transitionbackground-color9
ease-in-outtransitionbackground-color9
ease-in-out-o-transitionbackground-color9
data-slice-typealbumhover8
all8
sqs-slice-play-buttonicon-wrapper8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-outline8
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-center8
use-backgroundfillfffsqs-slide-wrapperdata-slide-typecover-page7
inputtypetextsqs-slide-wrapperdata-slide-typecover-page7
button-style-outlinesqs-modal-lightbox7
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-layout-style-stacked7
spansqs-slide-wrapperdata-slide-typecover-page7
use-iconfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page7
input-wrappernothidden7
show-track-title7
track7
social-icons-style-border7
video-icon-style-border7
data-slice-typemap7
use-backgroundfilltransparentsqs-slide-wrapperdata-slide-typecover-page7
sqs-slide-containerdata-slide-typepopup-overlayoverlay-alignment-left6
use-maskfillrgba3434344sqs-slide-wrapperdata-slide-typecover-page6
10px6
ulsqs-slide-wrapperdata-slide-typecover-page6
inputtypesubmitsqs-slide-wrapperdata-slide-typecover-page6
button-style-raised6
2em6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-rectangle6
audio-player-icons-style-border6
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-outline6
svgsocialbackground-colorrgba3434344sqs-slide-wrapperdata-slide-typecover-page6
input-wrapper6
audio-player-icons-style-solid6
track-progress-bar6
social-icons-style-regular6
sqs-slice-play-buttonicon-wrapperhover6
pinteresthover5
use-maskfilltransparentsqs-slide-wrapperdata-slide-typecover-page5
ituneshover5
social-icons-style-knockout5
meetuphover5
sqs-slice-album-playlistplaying5
mediumhover5
linkedinhover5
instagramhover5
imdbhover5
houzzhover5
rdiohover5
squarespacehover5
reddithover5
100ms5
youtubehover5
yelphover5
vscohover5
vinehover5
vimeohover5
ease-outopacity5
vevohover5
svgsocial-webkit-transitionbackground-color5
twitterhover5
audio-player-icons-style-regular5
rsshover5
twitchhover5
tumblrhover5
tidalhover5
thedotshover5
stumbleuponhover5
spotifyhover5
soundcloudhover5
snapchathover5
smugmughover5
6px5
googlehover5
stitcherhover5
applepodcasthover5
button-shape-rounded-corners5
dropboxhover5
dribbblehover5
sqs-slide-layer-content5
button-shape-pill5
emailhover5
codepenhover5
facebookhover5
gmnoprint5
googleplayhover5
behancehover5
fivehundredpixhover5
flickrhover5
gm-style-cc5
goodreadshover5
buttonsqs-slide-wrapperdata-slide-typecover-page5
foursquarehover5
bandsintownhover5
githubhover5
sqs-slide-containerdata-slide-typepopup-overlaynewsletter-style-underlined5
tweet-timestamp5
01s5
lock-style-regular5
icon-wrapperwidth24pxheight24pxmargin04
neuearialsans-seriffont-size16pxtext-transformnoneletter-spacing03emfont-weightnormalfont-stylenormalsqs-slide-wrapperdata-slide-typecover-page4
inputtypetext-moz-placeholdercolorrgba1631631635sqs-slide-wrapperdata-slide-typecover-page4
5px4
displaytablesqs-slide-wrapperdata-slide-typecover-page4
4px4
form-itemsqs-slide-wrapperdata-slide-typecover-page4
sqs-slide-layerlayer-front4
sqs-slide-containerdata-slide-typepopup-overlayoverlay-mobile-styles-enabledbutton-style-raised4
video-icon-style-regular4
audio-player-icons-style-knockout4
inputtypepassword-moz-placeholdercolorfffsqs-slide-wrapperdata-slide-typecover-page4
video-icon-style-solid4
neuearialsans-seriffont-weightnormalfont-stylenormalletter-spacing6pxsqs-slide-wrapperdata-slide-typecover-page4
use-iconfilltransparentsqs-slide-wrapperdata-slide-typecover-page4
responsive-wrapperwrapped4
lock-style-border4
group-copystacked4
map-style-minimal-dark4
track-title4
tweet-body4
ulstacked4
vertical-positioning-middle3
error-messagesqs-slide-wrapperdata-slide-typecover-page3
1px3
disclaimer-containersqs-slide-wrapperdata-slide-typecover-page3
sqs-slidesqs-slide-animation-ready3
sqs-slide-containerdata-slide-typepopup-overlayoverlay-load-animation-slide-in3
actionssqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containernotauto-image-background-color3
countdown-unit3
sqs-slide-containerdata-slide-typepopup-overlayenable-overlay-content-border3
responsive-wrapper3
data-slice-typegallerysqs-gallery-grid3
sqs-slice-custom-formsqs-slide-wrapperdata-slide-typecover-page3
autoflex13
button-style-solid3
ease-in-out-moz-transitioncolor3
inputtypesubmithoversqs-slide-wrapperdata-slide-typecover-page3
video-icon-style-knockout3
neuearialsans-seriffont-size15pxline-height14emtext-transformnoneletter-spacing03emfont-weightnormalfont-stylenormalcolorrgba00061sqs-slide-wrapperdata-slide-typecover-page3
lock-style-knockout3
lock-style-solid3
use-iconfillfffbackground-colorfffsqs-slide-wrapperdata-slide-typecover-page3
responsive-wrapperstackedtext-align-center3
svgsocialbackground-colortransparentsqs-slide-wrapperdata-slide-typecover-page3
use-iconfillrgba0005sqs-slide-wrapperdata-slide-typecover-page3
autosqs-slide-wrapperdata-slide-typecover-page3
adisplayblocksqs-slide-wrapperdata-slide-typecover-page3
sqs-slide-containerdata-slide-typepopup-overlaybutton-style-outline3
ease-in-out-ms-transitioncolor3
captcha-container-wrapper3
responsive-wrappernotstacked3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline-auto3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-auto3
sqs-slide-containerdata-slide-typepopup-overlaybutton-layout-style-inline3
data-slice-typebuttonssqs-slide-wrapperdata-slide-typecover-page3
ease-in-outtransitioncolor3
field-errordisplayblockpositionabsolutebox-sizingborder-boxpadding25em3
5emfont14px3
ease-in-out-o-transitioncolor3
sqs-slicedata-content-emptytruedisplaynonesqs-slide-wrapperdata-slide-typecover-page3
ease-in-moz-transitionopacity3
social-icons-size-smallsocial-icons-style-regular3
data-slice-typeheadingnotdata-compound-type3
use-iconfill1769ffsqs-slide-wrapperdata-slide-typecover-page3
arrow-icon3
easesqs-slide-wrapperdata-slide-typecover-page3
inputtypepasswordsqs-slide-wrapperdata-slide-typecover-page3
avisitedsqs-slide-wrapperdata-slide-typecover-page3
tweet-handle3
use-iconfill00b4b3sqs-slide-wrapperdata-slide-typecover-page3
tweet-display-name3
tweet-avatar3
use-iconfill000sqs-slide-wrapperdata-slide-typecover-page3
sqs-modal-lightbox3
buttontypesubmitsqs-slide-wrapperdata-slide-typecover-page3
use-iconfillea4c89sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill007ee5sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill3b5998sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0099e5sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0063dcsqs-slide-wrapperdata-slide-typecover-page3
use-iconfillf94877sqs-slide-wrapperdata-slide-typecover-page3
14px3
social-icons-size-extra-smallsocial-icons-style-regular3
use-iconfill382110sqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-smallsocial-icons-style-solid3
social-icons-size-largesocial-icons-style-regular3
8px3
social-icons-size-extra-largesocial-icons-style-regular3
social-icons-size-extra-smallsocial-icons-style-border3
social-icons-size-extra-smallsocial-icons-style-knockout3
social-icons-size-extra-smallsocial-icons-style-solid3
social-icons-size-smallsocial-icons-style-border3
social-icons-size-smallsocial-icons-style-knockout3
social-icons-size-mediumsocial-icons-style-border3
icon-wrapperborder2px3
social-icons-size-mediumsocial-icons-style-knockout3
social-icons-size-mediumsocial-icons-style-solid3
social-icons-size-largesocial-icons-style-border3
social-icons-size-largesocial-icons-style-knockout3
social-icons-size-largesocial-icons-style-solid3
social-icons-size-extra-largesocial-icons-style-border3
social-icons-size-extra-largesocial-icons-style-knockout3
social-icons-size-extra-largesocial-icons-style-solid3
use-iconfill4183c4sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill5adfcbsqs-slide-wrapperdata-slide-typecover-page3
ease-in-ms-transitionopacity3
use-iconfill55aceesqs-slide-wrapperdata-slide-typecover-page3
social-icons-size-mediumsocial-icons-style-regular3
icon-wrapperwidth28pxheight28pxmargin03
use-iconfilleb4924sqs-slide-wrapperdata-slide-typecover-page3
3px3
use-iconfill8c8070sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill35465dsqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperdiv-webkit-transformscale2-moz-transformscale2-ms-transformscale2transformscale2sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill6441a5sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillff0031sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill84bd00sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill1ab7easqs-slide-wrapperdata-slide-typecover-page3
use-iconfill00b488sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillae995asqs-slide-wrapperdata-slide-typecover-page3
use-iconfillc41200sqs-slide-wrapperdata-slide-typecover-page3
gallery-video-backgroundmobile3
use-iconfille52d27sqs-slide-wrapperdata-slide-typecover-page3
ease-intransitionopacity3
ease-in-o-transitionopacity3
use-iconfill1ea9e1sqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperwidth32pxheight32pxmargin03
use-iconfilldc4e41sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill0976b4sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill7ac143sqs-slide-wrapperdata-slide-typecover-page3
screen3
use-iconfille6b91esqs-slide-wrapperdata-slide-typecover-page3
only3
use-iconfille4405fsqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-album-playliststacked3
use-iconfillec4652sqs-slide-wrapperdata-slide-typecover-page3
sqs-slice-album-playlistdemo-album3
use-iconfill00ab6csqs-slide-wrapperdata-slide-typecover-page3
use-iconfillf60sqs-slide-wrapperdata-slide-typecover-page3
use-iconfille0393esqs-slide-wrapperdata-slide-typecover-page3
button-play-pause3
use-iconfillcc2127sqs-slide-wrapperdata-slide-typecover-page3
use-iconfill006ed2sqs-slide-wrapperdata-slide-typecover-page3
use-iconfillff4500sqs-slide-wrapperdata-slide-typecover-page3
7px3
use-iconfill7dbb00sqs-slide-wrapperdata-slide-typecover-page3
icon-wrapperwidth36pxheight36pxmargin03
design3

Who hosts Brigugl.io?

Brigugl.io Hosting Provider Information

Hosted IP Address:198.185.159.145
Hosted Hostname:198.185.159.145
Service Provider:Squarespace, Inc.
Hosted Country:United StatesUS
Location Latitude:40.7157
Location Longitude:-74
Webserver Software:Squarespace

Is "Squarespace, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
Squarespace, Inc.
1.2345%

HTTP Header Analysis for Brigugl.io

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
date: Sat, 24 Oct 2020 02:16:33 GMT
expires: Thu, 01 Jan 1970 00:00:00 GMT
x-content-type-options: nosniff
content-type: text/html;charset=utf-8
etag: W/"8e4eb13929c755c8254eccf1d14ac88c--gzip"
content-encoding: gzip
Vary: Accept-Encoding
Age: 544764
Accept-Ranges: bytes
Content-Length: 26592
x-contextid: uGbS6xFn/38wpdpXq
server: Squarespace

Brigugl.io Domain Nameserver Information

HostIP AddressCountry
c.dns.gandi.net 217.70.179.1
b.dns.gandi.net 213.167.229.1
a.dns.gandi.net 173.246.98.1


Need to find out who hosts Brigugl.io?


Domain Registration (WhoIs) information for Brigugl.io

 Domain Name: BRIGUGL.IO
Registry Domain ID: D503300000040566335-LRMS
Registrar WHOIS Server: whois.gandi.net
Registrar URL: https://www.gandi.net/whois
Updated Date: 2020-08-12T22:23:55Z
Creation Date: 2012-08-18T15:45:28Z
Registry Expiry Date: 2021-08-18T15:45:28Z
Registrar Registration Expiration Date:
Registrar: Gandi SAS
Registrar IANA ID: 81
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +33.170377661
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registrant Organization: Samuel Martin
Registrant State/Province: .
Registrant Country: FR
Name Server: C.DNS.GANDI.NET
Name Server: B.DNS.GANDI.NET
Name Server: A.DNS.GANDI.NET
DNSSEC: unsigned

>>> Last update of WHOIS database: 2020-10-30T09:35:00Z

Websites with Similar Names

Brigueporn.pro
BriguePorn
Brigugl.io
Louise Briguglio
Briguicar.com
Loading...
Briguydiy.com
Loading...
Briguysroblox.net
briguysroblox.net

Recently Updated Websites

Dariuszfrancuz.pl (2 minutes 11 seconds ago.)Kontrust.info (2 minutes 15 seconds ago.)Brevardsolar.com (2 minutes 21 seconds ago.)Aomori-akiya.org (2 minutes 27 seconds ago.)Gourbancharlotte.com (2 minutes 29 seconds ago.)Creativeshrimp.com (2 minutes 36 seconds ago.)Hdrinc.com (2 minutes 59 seconds ago.)Dragonbrandtkd.com (3 minutes 1 second ago.)Cookcountyil.gov (3 minutes 19 seconds ago.)Ytjzfw.com (3 minutes 21 seconds ago.)Com-www.com (3 minutes 22 seconds ago.)Auxihop.org (3 minutes 23 seconds ago.)Cheekfit.com (3 minutes 25 seconds ago.)Koleksiyonurunleri.com (3 minutes 25 seconds ago.)Entre-admis.com (3 minutes 27 seconds ago.)Macaverdenet.com.br (3 minutes 27 seconds ago.)Customvac.mb.ca (3 minutes 29 seconds ago.)Withoutdres.com (3 minutes 31 seconds ago.)Travisbernardphotos.com (3 minutes 36 seconds ago.)Netmedplus.com (3 minutes 36 seconds ago.)Empowermentlinguistico.com (3 minutes 36 seconds ago.)Techyfam.com (3 minutes 36 seconds ago.)T6cn.com (3 minutes 36 seconds ago.)Landmanninteractive.com (3 minutes 36 seconds ago.)Centr-audit.com (3 minutes 36 seconds ago.)Uniscrap.dk (8 minutes 9 seconds ago.)Equipecharbonneauetfils.com (8 minutes 21 seconds ago.)Mrpity.com (8 minutes 24 seconds ago.)Bellprescot.com (8 minutes 35 seconds ago.)Tubehardsex.com (8 minutes 40 seconds ago.)

Recently Searched Keywords

sanssans-serifcolorrgb0 (1 second ago.)inotpro-gallery-lovedcomp-k21rmmhb (2 seconds ago.)info-element-custom-button-wrapper buttoncomp-k21rmmhb pro-galleryinline-styles (2 seconds ago.)dasinc trading (3 seconds ago.)255 255comp-k21rmmhb pro-galleryinline-styles (6 seconds ago.)god eternal kefnet price (8 seconds ago.)importantcomp-k21rmmhb pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator (10 seconds ago.)communication protocol example (11 seconds ago.)255comp-k21rmmhb pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles (11 seconds ago.)xigent automation (12 seconds ago.)gallery-slideshow-info gallery-item-titlecomp-k21rmmhb pro-galleryinline-styles (13 seconds ago.)info-element-titlecomp-k21rmmhb pro-galleryinline-styles (14 seconds ago.)buttoncomp-k21rmmhb pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator (14 seconds ago.)o (15 seconds ago.)god-eternal kefnet edh (15 seconds ago.)buttoncomp-k21rmmhb pro-fullscreen-wrapper (15 seconds ago.)tao advanced metal (16 seconds ago.)offroad-club (17 seconds ago.)áo phông trắng cổ trụ (21 seconds ago.)cyprus residency yellow slip (23 seconds ago.)var1 var2 python (24 seconds ago.)operation requirements of partnership (29 seconds ago.)requirements operations manager (31 seconds ago.)operations requirements document (31 seconds ago.)operation requirements for the steam cracking process (34 seconds ago.)software engineering bottom-up approach (36 seconds ago.)bespokearchitects.com (42 seconds ago.)tou002finstant-photographyu003einstantu003cu002fnuxt-linku003eu003cu002fspanu003e (42 seconds ago.)smart n comfy armrest cushion (43 seconds ago.)n comfy (44 seconds ago.)