Brilio.net  |  Homepage | Brilio.net
Low trust score  | 
sdascsa

Brilio.net Website Information

Brilio.net has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 904, a Majestic Rank of 507,029, a Domain Authority of 10% and is not listed in DMOZ.

Brilio.net is hosted by PADINET - Padi Internet in Indonesia.
Brilio.net has an IP Address of 103.6.0.2 and a hostname of mdk-fe1.merdeka.com.

The domain brilio.net was registered 4 years 5 months 2 weeks ago by , it was last modified 4 years 3 months 4 weeks ago and currently is set to expire 3 years 5 months 2 weeks ago.


Whois information for brilio.net

Full Whois Lookup for Brilio.net Whois Lookup

Domain Name: BRILIO.NET
Registry Domain ID: 1905500010_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2017-02-25T02:58:14Z
Creation Date: 2015-02-26T06:01:55Z
Registry Expiry Date: 2019-02-26T06:01:55Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS-1162.AWSDNS-17.ORG
Name Server: NS-1760.AWSDNS-28.CO.UK
Name Server: NS-201.AWSDNS-25.COM
Name Server: NS-984.AWSDNS-59.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-18T06:43:19Z

Who hosts Brilio.net?

Brilio.net Web Server Information

Hosted IP Address:103.6.0.2
Hosted Hostname:mdk-fe1.merdeka.com
Service Provider:PADINET - Padi Internet
Hosted Country:IndonesiaID
Location Latitude:-6.175
Location Longitude:106.8286
Webserver Software:Not Applicable

HTTP Header Analysis for Brilio.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Thu, 11 Jun 2015 13:42:43 GMT
Content-Type: text/html
Content-Length: 3169
Connection: keep-alive
X-Powered-By: PHP/5.4.39-0 deb7u2
Expires: Thu, 11 Jun 2015 13:57:31 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Last-Modified: Thu, 11 Jun 2015 13:57:31 GMT
Vary: Accept-Encoding
Content-Encoding: gzip
X-XSS-Protection: 1;mode=block
X-Content-Type-Options: nosniff


Need to find out who hosts Brilio.net?

Brilio.net Free SEO Report

Website Inpage Analysis for Brilio.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Brilio.net

dalamselebritis sosok komunitas17 agustus 20174dariini bikinbisangakak selebritisbinatangwow1selebritis sosokyangada yangselebritisyang bisakecintakemerdekaan indonesiaspacebetweensaathut ritakngakak selebritis sosokke72paskibrakavideodantruebriliobeginibenderaartis indonesia18 agustushari kemerdekaancantikkuliner6duhinspiratifhutseremrayakancowokpotret7ngakak5paskibrakerenkemerdekaan riindonesia 17negarakenapakomunitasagustusartisri ke72indonesia 17 agustusalasosok komunitasvideo ngakak selebritisilmiahselebfilmbikinjadiiklanvideo ngakakputrikamuini ternyataunikhariternyatahut kemerdekaan risosokindonesia10 gaya17 agustushingga30varhut ri ke72kepribadian2tahunkemerdekaangayadislidesperviewhut kemerdekaanfotoiniagustus 2017olahraga18 agustus 2017adacewekfashionpopularridunia

Longtail Keyword Density for Brilio.net

KeywordsOccurences
17 agustus 201731
18 agustus 201723
hut ri ke-723
indonesia 17 agustus3
hut kemerdekaan ri3
ngakak selebritis sosok3
video ngakak selebritis3
selebritis sosok komunitas3
agustus 201754
17 agustus32
18 agustus23
artis indonesia6
ini bikin6
kemerdekaan indonesia4
hut kemerdekaan3
indonesia 173
kemerdekaan ri3
hut ri3
ri ke-723
ada yang3
hari kemerdekaan3
selebritis sosok3
ngakak selebritis3
sosok komunitas3
yang bisa3
10 gaya3
video ngakak3
ini ternyata3
057
agustus55
ini34
132
223
316
artis14
indonesia13
di12
var12
kemerdekaan12
kamu8
yang8
48
film8
bikin7
saat7
dari6
ada6
foto6
paskibraka6
ke6
56
potret6
ri6
hut6
bisa5
gaya5
video5
tak5
fashion5
sosok5
ngakak4
putri4
64
ala4
jadi4
true4
cewek4
cantik4
ke-724
binatang4
keren4
dan4
begini4
duh4
ilmiah4
bendera3
negara3
dunia3
inspiratif3
tahun3
paskibra3
hingga3
rayakan3
hari3
ternyata3
seleb3
iklan3
kuliner3
cinta3
wow3
kepribadian3
cowok3
olahraga3
serem3
komunitas3
selebritis3
dalam3
slidesperview3
spacebetween3
kenapa3
brilio3
unik3
popular3
73

What are the nameservers for brilio.net?

Brilio.net Domain Nameserver Information

HostIP AddressCountry
ns-cloud-d1.googledomains.com 216.239.32.109United States United States
ns-cloud-d2.googledomains.com 216.239.34.109United States United States
ns-cloud-d3.googledomains.com 216.239.36.109United States United States
ns-cloud-d4.googledomains.com 216.239.38.109United States United States

Brilio.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Brilio.net is a scam?