Domain summary

Last updated
2021-06-09
Domain label
britainfromabove
Domain extension
org.uk
Domain registered:
26-Nov-2009
Domain updated:
28-Sep-2020
Global Traffic Rank
304,897
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$30,780
Estimated daily income
$57
Estimated monthly income
$1,734

Frequently Asked Questions (FAQ)

Q: When was Britainfromabove.org.uk registered?
A: Britainfromabove.org.uk was registered 11 years, 9 months, 3 weeks, 4 days, 20 hours, 37 minutes, 20 seconds ago on Thursday, November 26, 2009.
Q: When was the WHOIS for Britainfromabove.org.uk last updated?
A: The WHOIS entry was last updated 11 months, 3 weeks, 2 days, 20 hours, 37 minutes, 20 seconds ago on Monday, September 28, 2020.
Q: What are Britainfromabove.org.uk's nameservers?
A: DNS for Britainfromabove.org.uk is provided by the following nameservers:
  • irnbru.scran.ac.uk
  • liveweb2.rcahms.gov.uk
  • scotweb.rcahms.gov.uk
Q: Who is the registrar for the Britainfromabove.org.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Britainfromabove.org.uk?
A: Britainfromabove.org.uk ranks 304,897 globally on Alexa. Britainfromabove.org.uk has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Britainfromabove.org.uk each day?
A: Britainfromabove.org.uk receives approximately 5,051 visitors and 20,204 page impressions per day.
Q: What IP address does Britainfromabove.org.uk resolve to?
A: Britainfromabove.org.uk resolves to the IPv4 address 193.63.89.85.
Q: In what country are Britainfromabove.org.uk servers located in?
A: Britainfromabove.org.uk has servers located in the United Kingdom.
Q: What webserver software does Britainfromabove.org.uk use?
A: Britainfromabove.org.uk is powered by Apache webserver.
Q: Who hosts Britainfromabove.org.uk?
A: Britainfromabove.org.uk is hosted by Jisc Services Limited in Wales, Pontypridd, United Kingdom, Cf38.
Q: How much is Britainfromabove.org.uk worth?
A: Britainfromabove.org.uk has an estimated worth of $30,780. An average daily income of approximately $57, which is roughly $1,734 per month.

Britainfromabove.org.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Britainfromabove.org.uk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Britainfromabove.org.uk

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

4 :

Total Images

42 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-32235074-4

Links - Internal

73:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Britainfromabove.org.uk

cookiesenabledjoinquotepw057399enablebuttonstoreupdatereturnago mick addedfunctionstatesettingstheirextractconsentyourimage epw048479added a pindocumentcookieday ago mickfalsedomaindata return objectassignpin to imagenecessaryagoaccnextstateifgetstateacc varprivacyformcontainerimage epw057399gmteffectshoursnoopdata returnsaved imagereturn objectassign stateupdateexportselseobjectassign statebannermick addedinputvaluequot 1 dayremovebannerbannercookiesreturn acc varcookiereturn accsavedpinday2data0httpsreturn functionstateobjectassignago mick1 day1ourfunctiontypesusecreatestorehours ago1 day agotruedata vardocumentqueryselectornameapplystorestatepathwritecookieday agostatesettingsdomainprofilequot 1groupsundefinedsecurefactorytheir profilestatesettingspathepw048479varfieldreturn objectassignanalyticsimageparamnewvalueacccurraddedmickinitformstore

Longtail Keyword Density for Britainfromabove.org.uk

KeywordsOccurences
added a pin14
pin to image14
1 day ago12
ago mick added10
day ago mick9
quot 1 day5
return acc var4
data return objectassign3
return objectassign state3
day ago12
1 day12
ago mick10
mick added10
image epw0484796
hours ago6
quot 15
return acc5
image epw0573994
acc var4
return functionstate4
saved image3
their profile3
data return3
return objectassign3
objectassign state3
data var3
var49
return47
function35
image19
if18
ago18
state15
pin15
added14
013
day12
mick10
objectassign9
acc8
cookies8
data7
update6
documentcookie6
cookie6
documentqueryselector6
hours6
epw0484796
getstate5
settings5
value5
quot5
our5
acccurr4
banner4
your4
path4
join4
functionstate4
applystore4
inputvalue4
statesettingsdomain4
types4
field4
false4
epw0573994
saved4
14
undefined4
groups4
else4
effects4
name4
true4
24
new4
removebannerbanner3
nextstate3
param3
initformstore3
storeupdate3
enablebutton3
extractconsent3
createstore3
https3
formcontainer3
necessary3
noop3
secure3
domain3
statesettingspath3
writecookie3
cookiesenabled3
use3
exports3
factory3
gmt3
privacy3
profile3
their3
analytics3

Who hosts Britainfromabove.org.uk?

Britainfromabove.org.uk Hosting Provider Information

Hosted IP Address:193.63.89.85
Hosted Hostname:193.63.89.85
Service Provider:Jisc Services Limited
Hosted Country:United KingdomGB
Location Latitude:51.5565
Location Longitude:-3.3558
Webserver Software:Apache

Is "Jisc Services Limited" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
Jisc Services Limited
0.0142%

HTTP Header Analysis for Britainfromabove.org.uk

Http-Version: 1.0
Status-Code: 200
Status: 200 OK
Date: Wed, 09 Jun 2021 23:57:45 GMT
Server: Apache
X-Content-Type-Options: nosniff
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Cache-Control: no-cache, must-revalidate
Content-Language: en
X-Frame-Options: SAMEORIGIN
Vary: Accept-Encoding
Content-Encoding: gzip
Strict-Transport-Security: max-age=31536000; includeSubDomains
Content-Security-Policy-Report-Only: default-src https: 'unsafe-inline' 'unsafe-eval'; img-src https: data: ; report-uri https://csp.rcahms.gov.uk/bfa-live;
Content-Length: 17975
Content-Type: text/html; charset=utf-8
Connection: keep-alive

Britainfromabove.org.uk Domain Nameserver Information

HostIP AddressCountry
irnbru.scran.ac.uk 194.81.222.247United Kingdom United Kingdom
liveweb2.rcahms.gov.uk 193.63.89.12United Kingdom United Kingdom
scotweb.rcahms.gov.uk 193.63.89.11United Kingdom United Kingdom


Need to find out who hosts Britainfromabove.org.uk?


Domain Registration (WhoIs) information for Britainfromabove.org.uk

 Domain name:
britainfromabove.org.uk

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 10-Dec-2012

Registrar:
Easily Limited t/a easily.co.uk [Tag = WEBCONSULTANCY]
URL: http://www.easily.co.uk

Relevant dates:
Registered on: 26-Nov-2009
Expiry date: 26-Nov-2020
Last updated: 05-Nov-2015

Registration status:
Registered until expiry date.

Name servers:
irnbru.scran.ac.uk
liveweb2.rcahms.gov.uk
scotweb.rcahms.gov.uk

WHOIS lookup made at 20:37:56 08-Sep-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Brita-filtry.cz
Brita-filtry.cz
Brita-in-pubs.eu
BRITA in PuBs
Brita-photography.com
brita-photography.com is coming soon
Brita.ae
BRITA water filter and BRITA water filter systems | BRITA®
Brita.at
BRITA Wasserfilter | BRITA®
Brita.ca
Water Filtration Systems for Your Home and Life - Brita® Canada
Brita.cn
碧然德BRITA中国官网-全球领先的饮用水优化专家
Brita.co.jp
浄水器と浄水システム | BRITA®
Brita.co.uk
BRITA water filter | BRITA®

Recently Updated Websites

Exposure.media (4 seconds ago.)Stemplaneta.eus (5 seconds ago.)Shareopus.com (5 seconds ago.)Borderlesstt.com (6 seconds ago.)Thechaplain.com (6 seconds ago.)Creativewebsiteawards.com (9 seconds ago.)Bayviewidahorealestate.com (10 seconds ago.)Chuckespinoza.com (10 seconds ago.)Sidselectric.us (11 seconds ago.)Ppc-pandora.com (12 seconds ago.)Momoiroclover.net (12 seconds ago.)Plusconceptinc.com (13 seconds ago.)Urology247.org (13 seconds ago.)Jobhouse.pl (15 seconds ago.)Southdenverobgyn.com (19 seconds ago.)Schwabsnewbraunfels.com (20 seconds ago.)Pitanguseditorial.com (20 seconds ago.)Kgabomerch.com (21 seconds ago.)Volcanoinsurance.net (22 seconds ago.)Mywalkisdifferent.com (24 seconds ago.)Kraftwagen.org (25 seconds ago.)Hochatown.realestate (26 seconds ago.)Wirrmann.com (26 seconds ago.)Adharfinance.com (27 seconds ago.)Greendynastiestrading.com (29 seconds ago.)Elissageorgeson.com (29 seconds ago.)Pokiesportal.com (31 seconds ago.)Uncensored.ninja (32 seconds ago.)Cryptoaffiliation.com (33 seconds ago.)Momolakamala.net (33 seconds ago.)

Recently Searched Keywords

shuapa (1 second ago.)www.shotbot.fr (3 seconds ago.)shipping boat (3 seconds ago.)setelah anda (5 seconds ago.)amp motorcycles (6 seconds ago.)habitual (6 seconds ago.)server deals (7 seconds ago.)7:00 amateur teen lesbians in dorm licking pussy (7 seconds ago.)senzakup (9 seconds ago.)firebrick near me (9 seconds ago.)seniography (10 seconds ago.)season 1 episode (12 seconds ago.)verified models (12 seconds ago.)cos2x differentiation (13 seconds ago.)scuderia ferrari replica collectionget ready for the track like a real race driverdiscover (13 seconds ago.)scottish5.25k (15 seconds ago.)cos2x-sin2x (17 seconds ago.)sat nav (18 seconds ago.)cos2x integration (18 seconds ago.)cos2x (19 seconds ago.)融资利率 (19 seconds ago.)safety cartoons (20 seconds ago.)international program (20 seconds ago.)cos2x identity (21 seconds ago.)sức khỏe tình dục (22 seconds ago.)pioneer village salem or (22 seconds ago.)gsd bankası (23 seconds ago.)sürdürülebilirlik (24 seconds ago.)wpbgalleryslidesflickitystaticheightstyle nectar-flickityinstace-5fe6f542a3c02notmasonry (24 seconds ago.)guumlncel (24 seconds ago.)