Britishgas.co.uk Website Analysis Summary

Britishgas.co.uk  |  British Gas is the largest UK energy and home services company. We supply gas and electricity, boilers and boiler cover as well as other home services.
Low trust score  | 
Gas and electricity, boilers and energy efficiency - British Gas


Rank
54,350
Rating
D
Trust Score
Low Trust Score
Estimated worth
$280,080
Estimated daily income
$389
Estimated monthly income
$11,832
Backlinks
0

Britishgas.co.uk has a Low Trust Score, and a Statvoo Rank of D.

Britishgas.co.uk is hosted by ANS Communications in England, Cambridge, United Kingdom, Cb1 5xh.
Britishgas.co.uk has an IP Address of 193.132.48.31 and a hostname of 193.132.48.31 and runs Apache/2.2.3 (Red Hat) web server.

The domain britishgas.co.uk was registered 2 decades 3 years 6 months ago by , it was last modified 6 years 2 months 3 weeks ago and currently is set to expire 201 decades 9 years 4 months ago.

It is the world's 54,350 most popular site among over 300 million websites.

Britishgas.co.uk has a total of 0 backlinks.

Britishgas.co.uk gets approximately 32,383 unique visitors a day and 194,298 pageviews per day.

Britishgas.co.uk has an estimated worth of $280,080.
An average daily income of approximately $389, which is wroughly $11,832 per month.

Whois information for britishgas.co.uk

Full Whois Lookup for Britishgas.co.uk Whois Lookup

Domain name:
britishgas.co.uk

Registrant:
GB Gas Holdings Limited

Registrant type:
UK Limited Company, (Company number: 3186121)

Registrant's address:
Millstream
Maidenhead Road
Windsor
SL4 5DG
United Kingdom

Data validation:
Nominet was able to match the registrant's name and address against a 3rd party data source on 10-Dec-2012

Registered through:
NetNames Limited
URL: http://www.netnames.co.uk

Registrar:
Ascio Technologies Inc. Denmark ? filial af Ascio Technologies Inc. USA t/a Ascio Technologies inc [Tag = ASCIO]
URL: http://www.ascio.com

Relevant dates:
Registered on: before Aug-1996
Expiry date: 28-Nov-2017
Last updated: 27-Nov-2015

Registration status:
Registered until expiry date.

Name servers:
ns1.netnames.net
ns2.netnames.net

WHOIS lookup made at 07:59:09 17-Aug-2017

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2017.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Who hosts Britishgas.co.uk?

Britishgas.co.uk Web Server Information

Hosted IP Address:193.132.48.31
Hosted Hostname:193.132.48.31
Service Provider:ANS Communications
Hosted Country:United KingdomGB
Location Latitude:51.7333
Location Longitude:-2.36667
Webserver Software:Apache/2.2.3 (Red Hat)

HTTP Header Analysis for Britishgas.co.uk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 12 Jun 2015 07:26:54 GMT
Server: Apache
Accept-Ranges: bytes
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Cache-Control: private
Content-Length: 15898
Content-Type: text/html; charset=UTF-8

Need to find out who hosts Britishgas.co.uk?

Britishgas.co.uk Free SEO Report

Website Inpage Analysis for Britishgas.co.uk

H1 Headings:0
H2 Headings:5
What do you need?
Energy
Our way of saying thank you.
Treat the family (or yourself!) on us.
Need something else?
H3 Headings:9
Energy
Home Services
Smart Homes
Help & Support
Make sure you're getting the very best deal, or just switch tariff - it's easy
Why pick us?
One-off repairs
Moving home
Book an engineer
H4 Headings:3
Discounts
Giveaways
Prize Days
H5 Headings:0
H6 Headings:0
Total IFRAMEs:1
Total Images:10
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Britishgas.co.uk

find outtempidexistingcurrentelementpushtempidnottariffactivetempiddivattrid ifcurrentelementundefinedsubscriptiongetfirstcurrentelementpushtempid unstyledcontainer resizepanelcontainertempidenergyunstyledcontainer windowoffresizeyou cancelifcurrentelementundefinedpostcodeviewlimitedheatingwindowoffresize windowresizepanelcontaineronresizeunstyledcontainer windowoffresize windowresizepanelcontaineronresizecancelledrewardswindowresizepanelcontaineronresizeofferfunctionunstyledcontainer resizepanelcontainertempidbritishout morenewoffersourusiftempiddivundefined tempiddivnull tempidonlinebookvarengineercreditgiftcancelfindvar tempiddivmorepricestempiddivnullwindowoffresize windowresizepanelcontaineronresize windowresizepanelcontainerrepairsyoumonthsfindpcpayresizepanelcontainertempid unstyledcontainerboilerfind out moreplanifyeartempiddivattridnew boilerstempiddivif youyour energyyourhivehive activeproducteligibleifcurrentelementundefined varupcustomerscurrentelementvar currentelement currentelementpushtempidif you cancelhomeformidcurrentelementpushtempid unstyledcontainercurrentelement currentelementpushtempidwelcomewindowresizepanelcontaineronresize windowresizepanelcontaineriftempiddivundefined tempiddivnullfreewelcome hometempid tempiddivattridtempiddivnull tempidhomecareifcurrentelementundefined var currentelementotherelectricitycurrentelement currentelementpushtempid unstyledcontainerwindowresizepanelcontainerhive active heatingunstyledcontainer resizepanelcontainertempid unstyledcontaineroneavailableresizepanelcontainertempidresizepanelcontainertempid unstyledcontainer windowoffresizecardunstyledcontainerboilersknowgift cardproductstempiddivattrid ifcurrentelementundefined vartempiddivnull tempid tempiddivattridbritish gasworthiftempiddivundefinedouttempid tempiddivattrid ifcurrentelementundefinedactive heatingwindowoffresizegasvar currentelement

Longtail Keyword Density for Britishgas.co.uk

KeywordsOccurences
unstyled-container resizepanelcontainertempid unstyled-container6
currentelementpushtempid unstyled-container resizepanelcontainertempid6
resizepanelcontainertempid unstyled-container windowoffresize6
unstyled-container windowoffresize windowresizepanelcontaineronresize6
windowoffresize windowresizepanelcontaineronresize windowresizepanelcontainer6
var currentelement currentelementpushtempid6
currentelement currentelementpushtempid unstyled-container6
iftempiddivundefined tempiddivnull tempid6
tempiddivnull tempid tempiddivattrid6
tempid tempiddivattrid ifcurrentelementundefined6
tempiddivattrid ifcurrentelementundefined var6
ifcurrentelementundefined var currentelement6
find out more4
if you cancel3
hive active heating3
british gas10
unstyled-container resizepanelcontainertempid6
currentelementpushtempid unstyled-container6
currentelement currentelementpushtempid6
ifcurrentelementundefined var6
resizepanelcontainertempid unstyled-container6
windowresizepanelcontaineronresize windowresizepanelcontainer6
windowoffresize windowresizepanelcontaineronresize6
unstyled-container windowoffresize6
tempiddivattrid ifcurrentelementundefined6
var currentelement6
var tempiddiv6
tempid tempiddivattrid6
iftempiddivundefined tempiddivnull6
gift card6
tempiddivnull tempid6
if you4
out more4
find out4
welcome home4
you cancel3
active heating3
hive active3
your energy3
new boilers3
you19
your18
var15
unstyled-container12
if11
our11
gas11
british10
home10
hive9
homecare8
customers7
offer7
heating7
new7
energy6
tempiddiv6
formid6
iftempiddivundefined6
tempid6
currentelementpushtempid6
windowresizepanelcontaineronresize6
windowoffresize6
currentelement6
ifcurrentelementundefined6
tempiddivattrid6
windowresizepanelcontainer6
resizepanelcontainertempid6
tempiddivnull6
card6
gift6
out6
available5
find5
more5
prices5
get5
not5
offers5
boilers4
pay4
existing4
product4
months4
cancelled4
postcode4
welcome4
boiler4
plan4
rewards3
other3
products3
limited3
one3
eligible3
first3
year3
cancel3
view3
subscription3
us3
free3
engineer3
know3
tariff3
online3
repairs3
worth3
book3
up3
credit3
electricity3
findpc3
function3
active3

What are the nameservers for britishgas.co.uk?

Britishgas.co.uk Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown