Brookings.in Favicon Brookings.in

Brookings.in Website Thumbnail
Checking...
Brookings India
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
brookings
Domain extension
in
Domain registered:
2012-01-08
Domain updated:
2020-10-20
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is brookings.in ranked relative to other sites:

Percentage of visits to brookings.in from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Brookings.in registered?
A: Brookings.in was registered 8 years, 9 months, 3 weeks, 2 days, 4 hours, 55 minutes ago on Sunday, January 8, 2012.
Q: When was the WHOIS for Brookings.in last updated?
A: The WHOIS entry was last updated 1 week, 4 days, 4 hours, 55 minutes ago on Tuesday, October 20, 2020.
Q: What are Brookings.in's nameservers?
A: DNS for Brookings.in is provided by the following nameservers:
  • dns01.brookings.edu
  • dns02.brookings.edu
  • dns03.brookings.edu
Q: Who is the registrar for the Brookings.in domain?
A: The domain has been registered at INRegistry.
Q: What is the traffic rank for Brookings.in?
A: Brookings.in has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Brookings.in each day?
A: Brookings.in receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Brookings.in resolve to?
A: Brookings.in resolves to the IPv4 address 40.71.11.185.
Q: In what country are Brookings.in servers located in?
A: Brookings.in has servers located in the United States.
Q: What webserver software does Brookings.in use?
A: Brookings.in is powered by Microsoft-IIS/10.0 webserver.
Q: Who hosts Brookings.in?
A: Brookings.in is hosted by Microsoft Corporation in Virginia, Washington, United States, 22747.
Q: How much is Brookings.in worth?
A: Brookings.in has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Brookings.in?

Brookings.in Hosting Provider Information

Hosted IP Address:40.71.11.185
Hosted Hostname:40.71.11.185
Service Provider:Microsoft Corporation
Hosted Country:United StatesUS
Location Latitude:38.7095
Location Longitude:-78.1539
Webserver Software:Microsoft-IIS/10.0

Is "Microsoft Corporation" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Brookings.in

Http-Version: 1.1
Status-Code: 302
Status: 302 Redirect
Content-Length: 171
Content-Type: text/html; charset=UTF-8
Location: https://www.brookings.edu/center/brookings-india
Server: Microsoft-IIS/10.0
X-Powered-By: ASP.NET
Date: Tue, 20 Oct 2020 01:05:25 GMT

Brookings.in Domain Nameserver Information

HostIP AddressCountry
dns01.brookings.edu 192.245.194.6United States United States
dns02.brookings.edu 192.245.194.7United States United States
dns03.brookings.edu 192.245.194.9United States United States


Need to find out who hosts Brookings.in?


Domain Registration (WhoIs) information for Brookings.in

 Domain Name: brookings.in
Registry Domain ID: D6670006-IN
Registrar WHOIS Server:
Registrar URL: http://www.key-systems.net
Updated Date: 2019-12-04T13:12:23Z
Creation Date: 2012-08-01T14:02:11Z
Registry Expiry Date: 2020-08-01T14:02:11Z
Registrar: Key-Systems GmbH
Registrar IANA ID: 269
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: ok http://www.icann.org/epp#OK
Registry Registrant ID:
Registrant Name:
Registrant Organization: The Brookings Institution
Registrant Street:
Registrant Street:
Registrant Street:
Registrant City:
Registrant State/Province: DC
Registrant Postal Code:
Registrant Country: US
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Please contact the Registrar listed above
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin Street:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Please contact the Registrar listed above
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech Street:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Please contact the Registrar listed above
Name Server: dns01.brookings.edu
Name Server: dns04.brookings.edu
Name Server: dns02.brookings.edu
Name Server: dns03.brookings.edu
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-06-12T12:16:00Z

Brookings.in Free SEO Report

Website Inpage Analysis for Brookings.in

H1 Headings

2 :
  1. Brookings India
  2. Brookings India

H2 Headings

5 :
  1. Research
  2. Events
  3. Op-Eds
  4. Blog Posts
  5. The Brookings Institution

H3 Headings

0 :

H4 Headings

17 :
  1. Book Launch & Panel Discussion | Future of Coal in India: Smooth Transition or Bumpy Road Ahead?
  2. Online Only
  3. Neighbourhood first responder: India’s humanitarian assistance and disaster relief
  4. When land comes in the way: India’s connectivity infrastructure in Nepal
  5. Digitising India inevitably means tackling egregious access gaps
  6. Travel South Asia: India’s tourism connectivity with the region
  7. Mining and Jurisprudence: Observations for India’s mining sector to improve environmental and social performance
  8. Skewed critical minerals global supply chains post COVID-19
  9. India and the European Union: Next steps in strategic partnership
  10. Web workshop with the office of the Principal Accountant General (Audit), Bihar
  11. Webinar | Fractured Global Value Chains post COVID-19: Can India gain its missed glory?
  12. How COVID-19 might impact India’s renewable energy transition
  13. Is Modi’s balancing act a reworking of India’s classic non-aligned posture?
  14. The debate over jobs in India is missing the point
  15. Reviving energy cooperation in South Asia
  16. Why India’s push for private-sector coal mining won’t raise carbon emissions
  17. Bhutan’s democratic transition and ties to India

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

12 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

76:
  1. Brookings About Us
    https://www.brookings.edu/about-us/
  2. Brookings Press Room
    https://www.brookings.edu/press/
  3. Brookings WashU at Brookings
    https://www.brookings.edu/executive-education/
  4. Brookings Support Brookings
    https://support.brookings.edu/
  5. Brookings Cart 0
    https://brookings.foxycart.com/cart?cart-view
  6. Brookings Guidance for the Brookings community and the public on our response to the coronavirus (COVID-19) »
    https://www.brookings.edu/coronavirus-covid-19-guidance/
  7. Brookings Learn more from Brookings scholars about the global response to coronavirus (COVID-19) »
    https://www.brookings.edu/topic/coronavirus-covid19/
  8. Brookings The Brookings Institution The Brookings Institution
    https://www.brookings.edu/
  9. Brookings AI
    https://www.brookings.edu/project/artificial-intelligence-and-emerging-technology-initiative/
  10. Brookings Policy 2020
    https://www.brookings.edu/policy2020/home/
  11. Brookings Cities & Regions
    https://www.brookings.edu/topic/cities-regions/
  12. Brookings Global Dev
    https://www.brookings.edu/topic/global-development/
  13. Brookings Intl Affairs
    https://www.brookings.edu/topic/international-affairs/
  14. Brookings U.S. Economy
    https://www.brookings.edu/topic/u-s-economy/
  15. Brookings U.S. Politics & Govt
    https://www.brookings.edu/topic/u-s-politics-government/
  16. Brookings Centre for Social and Economic Progress
    https://csep.org/
  17. Brookings 2020 Sep 7 Past Event Book Launch & Panel Discussion | Future of Coal in India: Smooth Transition or Bumpy Road Ahead?
    https://www.brookings.edu/events/book-launch-panel-discussion-future-of-coal-in-india-smooth-transition-or-bumpy-road-ahead/
  18. Brookings Online Only Location Map
    http://maps.google.com?q=United%20States
  19. https://www.brookings.edu/research/neighbourhood-first-responder-indias-humanitarian-assistance-and-disaster-relief/
    https://www.brookings.edu/research/neighbourhood-first-responder-indias-humanitarian-assistance-and-disaster-relief/
  20. Brookings India
    https://www.brookings.edu/topic/india/
  21. Brookings Neighbourhood first responder: India’s humanitarian assistance and disaster relief
    https://www.brookings.edu/research/neighbourhood-first-responder-indias-humanitarian-assistance-and-disaster-relief/
  22. Brookings Saneet Chakradeo
    https://www.brookings.edu/author/saneet-chakradeo/
  23. https://www.brookings.edu/research/when-land-comes-in-the-way-indias-connectivity-infrastructure-in-nepal/
    https://www.brookings.edu/research/when-land-comes-in-the-way-indias-connectivity-infrastructure-in-nepal/
  24. Brookings When land comes in the way: India’s connectivity infrastructure in Nepal
    https://www.brookings.edu/research/when-land-comes-in-the-way-indias-connectivity-infrastructure-in-nepal/
  25. Brookings Constantino Xavier
    https://www.brookings.edu/experts/constantino-xavier/
  26. Brookings Riya Sinha
    https://www.brookings.edu/author/riya-sinha/
  27. https://indianexpress.com/article/opinion/columns/sundar-pichai-google-education-digital-india-6544793/
    https://indianexpress.com/article/opinion/columns/sundar-pichai-google-education-digital-india-6544793/
  28. Brookings Digitising India inevitably means tackling egregious access gaps
    https://indianexpress.com/article/opinion/columns/sundar-pichai-google-education-digital-india-6544793/
  29. Brookings Bhaskar Chakravorti
    https://www.brookings.edu/experts/bhaskar-chakravorti/
  30. https://www.brookings.edu/research/travel-south-asia-indias-tourism-connectivity-with-the-region/
    https://www.brookings.edu/research/travel-south-asia-indias-tourism-connectivity-with-the-region/
  31. Brookings South Asia
    https://www.brookings.edu/topic/south-asia/
  32. Brookings Travel South Asia: India’s tourism connectivity with the region
    https://www.brookings.edu/research/travel-south-asia-indias-tourism-connectivity-with-the-region/
  33. Brookings Bhumika Sharma
    https://www.brookings.edu/author/bhumika-sharma/
  34. https://www.brookings.edu/research/mining-and-jurisprudence-observations-for-indias-mining-sector-to-improve-environmental-and-social-performance/
    https://www.brookings.edu/research/mining-and-jurisprudence-observations-for-indias-mining-sector-to-improve-environmental-and-social-performance/
  35. Brookings Mining and Jurisprudence: Observations for India’s mining sector to improve environmental and social performance
    https://www.brookings.edu/research/mining-and-jurisprudence-observations-for-indias-mining-sector-to-improve-environmental-and-social-performance/
  36. Brookings Srestha Banerjee
    https://www.brookings.edu/author/srestha-banerjee/
  37. https://www.brookings.edu/research/skewed-critical-minerals-global-supply-chains-post-covid-19/
    https://www.brookings.edu/research/skewed-critical-minerals-global-supply-chains-post-covid-19/
  38. Brookings Energy Industry
    https://www.brookings.edu/topic/energy-industry/
  39. Brookings Skewed critical minerals global supply chains post COVID-19
    https://www.brookings.edu/research/skewed-critical-minerals-global-supply-chains-post-covid-19/
  40. Brookings Rajesh Chadha
    https://www.brookings.edu/author/rajesh-chadha/
  41. Brookings 2020 Jul 16 Past Event India and the European Union: Next steps in strategic partnership 12:00 PM - 1:00 PM IST Online Only
    https://www.brookings.edu/events/india-and-the-european-union-next-steps-in-strategic-partnership/
  42. Brookings 2020 Jun 25 Past Event Web workshop with the office of the Principal Accountant General (Audit), Bihar 11:00 AM - 1:00 PM IST Online only
    https://www.brookings.edu/events/web-workshop-with-the-office-of-the-principal-accountant-general-audit-bihar/
  43. Brookings 2020 May 29 Past Event Webinar | Fractured Global Value Chains post COVID-19: Can India gain its missed glory? 5:30 PM - 7:00 PM IST Online Only
    https://www.brookings.edu/events/webinar-fractured-global-value-chains-post-covid-19-can-india-gain-its-missed-glory/
  44. https://www.brookings.edu/opinions/how-covid-19-might-impact-indias-renewable-energy-transition/
    https://www.brookings.edu/opinions/how-covid-19-might-impact-indias-renewable-energy-transition/
  45. Brookings Coronavirus (COVID-19)
    https://www.brookings.edu/topic/coronavirus-covid19/
  46. Brookings How COVID-19 might impact India’s renewable energy transition
    https://www.brookings.edu/opinions/how-covid-19-might-impact-indias-renewable-energy-transition/
  47. Brookings Rahul Tongia
    https://www.brookings.edu/experts/rahul-tongia/
  48. https://www.brookings.edu/opinions/is-modis-balancing-act-a-reworking-of-indias-classic-non-aligned-posture/
    https://www.brookings.edu/opinions/is-modis-balancing-act-a-reworking-of-indias-classic-non-aligned-posture/
  49. Brookings Is Modi’s balancing act a reworking of India’s classic non-aligned posture?
    https://www.brookings.edu/opinions/is-modis-balancing-act-a-reworking-of-indias-classic-non-aligned-posture/
  50. https://www.brookings.edu/opinions/the-debate-over-jobs-in-india-is-missing-the-point/
    https://www.brookings.edu/opinions/the-debate-over-jobs-in-india-is-missing-the-point/
  51. Brookings The debate over jobs in India is missing the point
    https://www.brookings.edu/opinions/the-debate-over-jobs-in-india-is-missing-the-point/
  52. Brookings Shamika Ravi
    https://www.brookings.edu/experts/shamika-ravi/
  53. https://www.brookings.edu/blog/up-front/2020/07/31/reviving-energy-cooperation-in-south-asia/
    https://www.brookings.edu/blog/up-front/2020/07/31/reviving-energy-cooperation-in-south-asia/
  54. Brookings Up Front
    https://www.brookings.edu/blog/up-front/
  55. Brookings Reviving energy cooperation in South Asia
    https://www.brookings.edu/blog/up-front/2020/07/31/reviving-energy-cooperation-in-south-asia/
  56. Brookings Saheb Singh Chadha
    https://www.brookings.edu/author/saheb-singh-chadha/
  57. https://www.brookings.edu/blog/planetpolicy/2020/07/20/why-indias-push-for-private-sector-coal-mining-wont-raise-carbon-emissions/
    https://www.brookings.edu/blog/planetpolicy/2020/07/20/why-indias-push-for-private-sector-coal-mining-wont-raise-carbon-emissions/
  58. Brookings PlanetPolicy
    https://www.brookings.edu/blog/planetpolicy/
  59. Brookings Why India’s push for private-sector coal mining won’t raise carbon emissions
    https://www.brookings.edu/blog/planetpolicy/2020/07/20/why-indias-push-for-private-sector-coal-mining-wont-raise-carbon-emissions/
  60. https://www.brookings.edu/blog/up-front/2020/07/08/bhutans-democratic-transition-and-ties-to-india/
    https://www.brookings.edu/blog/up-front/2020/07/08/bhutans-democratic-transition-and-ties-to-india/
  61. Brookings Bhutan’s democratic transition and ties to India
    https://www.brookings.edu/blog/up-front/2020/07/08/bhutans-democratic-transition-and-ties-to-india/
  62. Brookings The Brookings Institution
    https://www.brookings.edu/
  63. Brookings Facebook Find us on Facebook
    http://www.facebook.com/brookings
  64. Brookings Twitter Find us on Twitter
    https://twitter.com/BrookingsInst
  65. Brookings YouTube Find us on YouTube
    http://www.youtube.com/user/BrookingsInstitution
  66. Brookings Podcast Listen to our Podcast
    https://www.brookings.edu/podcasts/
  67. Brookings Browse Newsletters Browse Newsletters
    https://www.brookings.edu/newsletters/
  68. Brookings RSS Subscribe to our RSS
    https://www.brookings.edu/feeds/
  69. Brookings Español
    https://www.brookings.edu/es/
  70. Brookings 中文
    https://www.brookings.edu/zh-cn/
  71. Brookings عربي
    https://www.brookings.edu/ar/
  72. Brookings Contact
    https://www.brookings.edu/contact-brookings/
  73. Brookings Terms and Conditions
    https://www.brookings.edu/terms-and-conditions/
  74. Brookings Brookings Privacy Policy
    https://www.brookings.edu/about-us/brookings-institution-privacy-policy/
  75. Brookings U.S. Politics & Government
    https://www.brookings.edu/topic/u-s-politics-government/
  76. Brookings Campaigns & Elections
    https://www.brookings.edu/topic/campaigns-elections/

Links - Outbound (nofollow)

0:

Keyword Cloud for Brookings.in

july1onlineglobalresearchconstantinoaugustist onlinedocumentwriteourist online onlybrookingssouthpoliticsview allonlyxavieronline onlypmevents0past eventinstitutionpm ist onlinepm ist2020 indiasouth asiafind usenergyviewpolicyuscoronavirusindiastransitionsearchconstantino xaviercoronavirus covid19india8217sminingeventistbrookings institutionus politicscovid19moremondayindiafindamppastallasiawednesdaybrookings india

Longtail Keyword Density for Brookings.in

KeywordsOccurences
pm ist online4
ist online only4
brookings institution6
past event4
pm ist4
ist online4
online only4
2020 india4
view all4
coronavirus covid-193
brookings india3
us politics3
constantino xavier3
south asia3
find us3
019
brookings18
india17
us10
pm7
institution7
covid-196
documentwrite6
view5
july5
global5
wednesday5
amp5
all4
find4
august4
indias4
only4
online4
search4
ist4
event4
past4
14
policy4
mining3
india8217s3
events3
our3
coronavirus3
energy3
monday3
more3
transition3
south3
research3
xavier3
constantino3
politics3
asia3

Brookings.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Brook-family.com
Want your own website? | 123 Reg
Brook-hill.ca
Brook Hill -
Brook-hill.net
The Brook Hill Family
Brook-intl.com
BROOK INTERNATIONAL
Brook-lin7.com
Brook-Lin7.com
Brook-man.com
金沙js娱乐场官方网站【欢迎您】金沙js娱乐场官方网站【欢迎您】
Brook-meadow.com
Brook Meadow Village Apartments - Brook Meadow Apartments in Austin
Brook-side.com
Brook Side
Brook-sky.com
新葡京网址_北京pk10_39499

Recently Updated Websites

Coviranfrey.com 2 seconds ago.Imomentous.com 4 seconds ago.Smithandwedgens.com 5 seconds ago.Harpdirect.com 7 seconds ago.Servicedlondonlets.com 7 seconds ago.Blickpictures.com 7 seconds ago.Audeaproductions.com 8 seconds ago.Directionsuniversity.com 8 seconds ago.Birthcottage.com 10 seconds ago.Tifochieti.com 11 seconds ago.The100days.com 11 seconds ago.Struttersball.com 11 seconds ago.Simplymalaysiaholiday.com 12 seconds ago.Loesshillsalliance.com 12 seconds ago.Freshandfly.jp 12 seconds ago.Stivanplumbing.com 13 seconds ago.Attractivelyvintage.com 13 seconds ago.Historiacultural.net 14 seconds ago.Turningscience.com 15 seconds ago.Adtrancomms.mobi 15 seconds ago.Apromore.org 15 seconds ago.Dennisorchard.com 16 seconds ago.Igetsystems.com 17 seconds ago.Kaiklong.com 17 seconds ago.Putki.com 18 seconds ago.Agen-pulsa.com 18 seconds ago.Viettamduc.com 18 seconds ago.2chicksonsports.com 19 seconds ago.Bjpaintinganddec.com 19 seconds ago.Geth.ethereum.org 20 seconds ago.