Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 139,821
Estimated Worth: $71,400



Domain summary

Last updated
2020-11-04
Domain label
bue
Domain extension
edu.eg
Global Traffic Rank
139,821
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$71,400
Estimated daily income
$119
Estimated monthly income
$3,620

Frequently Asked Questions (FAQ)

Q: When was Bue.edu.eg registered?
A: Bue.edu.eg was registered 11 months, 2 weeks, 5 days, 17 hours, 8 minutes, 29 seconds ago on Wednesday, November 4, 2020.
Q: When was the WHOIS for Bue.edu.eg last updated?
A: The WHOIS entry was last updated 11 months, 2 weeks, 5 days, 17 hours, 8 minutes, 29 seconds ago on Wednesday, November 4, 2020.
Q: What are Bue.edu.eg's nameservers?
A: DNS for Bue.edu.eg is provided by the following nameservers:
  • frcu.eun.eg
  • ns2.bue.edu.eg
Q: Who is the registrar for the Bue.edu.eg domain?
A: The domain has been registered at .
Q: What is the traffic rank for Bue.edu.eg?
A: Bue.edu.eg ranks 139,821 globally on Alexa. Bue.edu.eg has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Bue.edu.eg each day?
A: Bue.edu.eg receives approximately 9,526 visitors and 47,630 page impressions per day.
Q: What IP address does Bue.edu.eg resolve to?
A: Bue.edu.eg resolves to the IPv4 address 178.162.193.50.
Q: In what country are Bue.edu.eg servers located in?
A: Bue.edu.eg has servers located in the Germany.
Q: What webserver software does Bue.edu.eg use?
A: Bue.edu.eg is powered by Nginx webserver.
Q: Who hosts Bue.edu.eg?
A: Bue.edu.eg is hosted by Leaseweb Deutschland GmbH in Germany.
Q: How much is Bue.edu.eg worth?
A: Bue.edu.eg has an estimated worth of $71,400. An average daily income of approximately $119, which is roughly $3,620 per month.

Bue.edu.eg Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Bue.edu.eg Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Bue.edu.eg

H1 Headings

0 :

H2 Headings

8 :
  1. Top Private
  2. Accredited University
  3. in QS Ranking
  4. BUE COVID-19 CORONA VIRUS GUIDANCE
  5. Recently Happened
  6. Upcoming
  7. A Different Educational Experience!
  8. Get Closer To Your Goal, Choose a Faculty!

H3 Headings

4 :
  1. Welcome to The British University in Egypt!
  2. Induction 2020
  3. Important Announcement Congratulations
  4. COVID-19 and Online Teaching: BUE’s Staff Perspectives

H4 Headings

20 :
  1. Q&V
  2. E-Learning
  3. SRS
  4. Library
  5. Student Union
  6. FAQ's
  7. Arts & Humanities
  8. BAEPS
  9. CMM
  10. Dentistry
  11. Engineering
  12. ICS
  13. Law
  14. Nursing
  15. Pharmacy
  16. Energy Engineering
  17. Arts & Design
  18. Get Social
  19. Contacts
  20. Useful Links

H5 Headings

26 :
  1. Open Days
  2. Admission
  3. Campus Map
  4. Virtual Tour
  5. Student Activities
  6. Annual growth
  7. Undergraduate Courses
  8. Undergraduate Courses
  9. Postgraduate Courses
  10. Undergraduate Courses
  11. Undergraduate Courses
  12. Postgraduate Courses
  13. Undergraduate Courses
  14. Postgraduate Courses
  15. Undergraduate Courses
  16. Postgraduate Courses
  17. Undergraduate Courses
  18. Undergraduate Courses
  19. Undergraduate Courses
  20. Undergraduate Courses
  21. Undergraduate Courses
  22. BUE Research
  23. Teaching & Learning
  24. Community Services
  25. Student Induction
  26. Induction 2020

H6 Headings

17 :
  1. Message From the President
  2. Fast Admission Steps
  3. Contingency plan for learning and teaching
  4. Staying safe
  5. General guide for students
  6. General guide for staff
  7. Faculty of Arts and Design — Guidelines for Aptitude Tests
  8. Message From the President
  9. News
  10. Contingency plan for learning and teaching
  11. Staying safe
  12. General guide for students
  13. General guide for staff
  14. Students on Campus
  15. Accredited Private University in QS Ranking
  16. Papers Published in Scopus in 2019
  17. External Research Funding

Total IFRAMEs

0 :

Total Images

56 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

184:

Links - Outbound (nofollow)

6:

Keyword Cloud for Bue.edu.eg

sciencemr mohamed faridguidancedevelopmentampwellprogrammehtmldivinnerhtml htmldivcss elsecomputerhtmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0group5oriental weaversbreakpointjointaddition0px 0pxpresidentpetrochemicalscomputer sciencehtmldivinnerhtml htmldivcss0pxelsevirus guidancemengcoursespostgraduatecourses bachelorimportantmschasifhtmldiv htmldivinnerhtml htmldivinnerhtmlqmu1committeetrueits boardagreementengineeringinductionmargintopmediaplancouncilcommunitypartygeneraljoint boardpostgraduatecorona virusallfoundationsettings slidestoshownowscientificguideindustriesnewadvancedegypthtmldivcssstudentvarjsslidestoscrollbuedocumentcreateelementdiv htmldivinnerhtmlerrormessageyoucoronaitsfacultyenergy engineeringhtmldiv documentcreateelementdiv htmldivinnerhtmlhtmldivinnerhtml htmldivinnerhtmldegreestudentsprojectselse varbritishread moreheorientalifhtmldivhtmldivlearningbritish universitycolormohamed faridboardenergy6staffreadinstitutionsvar htmldiv documentcreateelementdivconstructionhtmldivcss else varincludedocumentcreateelementdiv htmldivinnerhtml htmldivcsselse var htmldivdevelopcoursesundergraduate coursespostgraduate coursescoursespartnershipbachelor degreeslidertoporientalsnextcoursespostgraduate coursesundergraduate courseslibrarycoursespostgraduate coursesundergraduateresearchstudiesincludesfaridcovid19 corona viruskhamismr mohamedweaversmorerenewablenursingprevscrollpossdesignundergraduatehtmldivcss else038covid19 coronamrsettingsbachelorhtmldiv documentcreateelementdivcoursesundergraduateindustryfounderhtmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0obituaryvar htmldivhtmldivinnerhtml htmldivinnerhtml htmldivcssslidestoshowinternationalfarid khamisrevolutionendteachingsenateannualdevelopment orientalsvirusproductshtmldivinnerhtmlifhtmldiv htmldivinnerhtmlmakeifcoursesundergraduate courses bachelor2mohameduniversity in egyptgeneral guidecourses bachelor degreeartsfunctionbodyvar htmldiv documentgetelementbyidrspluginsettingsinlinecssvisitvar htmldivcss4qualityboard of trusteeschairman of its03mohamed farid khamisegyptianbackgroundcoloruniversitycovid19corona virus guidancehtmldiv documentgetelementbyidrspluginsettingsinlinecssdocumentgetelementbyidrspluginsettingsinlinecssdocumentcreateelementdivtrusteessomechairmantheir

Longtail Keyword Density for Bue.edu.eg

KeywordsOccurences
university in egypt9
board of trustees6
else var htmldiv4
coursespostgraduate coursesundergraduate courses4
var htmldiv documentgetelementbyidrs-plugin-settings-inline-css4
ifhtmldiv htmldivinnerhtml htmldivinnerhtml4
htmldivinnerhtml htmldivinnerhtml htmldivcss4
htmldivinnerhtml htmldivcss else4
htmldivcss else var4
mohamed farid khamis4
var htmldiv documentcreateelementdiv4
htmldiv documentcreateelementdiv htmldivinnerhtml4
documentcreateelementdiv htmldivinnerhtml htmldivcss4
htmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes04
coursesundergraduate courses bachelor3
mr mohamed farid3
corona virus guidance3
covid-19 corona virus3
chairman of its3
courses bachelor degree3
coursesundergraduate courses11
british university10
var htmldiv8
htmldivinnerhtml htmldivcss8
documentcreateelementdiv htmldivinnerhtml4
coursespostgraduate coursesundergraduate4
oriental weavers4
general guide4
postgraduate courses4
energy engineering4
mohamed farid4
htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes04
mr mohamed4
htmldiv documentcreateelementdiv4
joint board4
htmldivcss else4
htmldivinnerhtml htmldivinnerhtml4
ifhtmldiv htmldivinnerhtml4
htmldiv documentgetelementbyidrs-plugin-settings-inline-css4
farid khamis4
else var4
courses bachelor3
bachelor degree3
settings slidestoshow3
read more3
computer science3
development orientals3
virus guidance3
corona virus3
covid-19 corona3
var htmldivcss3
its board3
0px 0px3
engineering20
var20
university19
03816
bue16
courses15
egypt14
amp14
htmldivinnerhtml12
board12
british11
coursesundergraduate11
htmldivcss11
qmu10
science10
function9
chairman9
08
egyptian8
htmldiv8
development7
0px7
research7
students7
17
else7
international6
errormessage6
he6
important6
programme6
energy6
trustees6
founder6
if6
all6
mohamed6
khamis6
includes5
arts5
president5
teaching5
its5
student5
joint5
nursing5
senate5
general5
new4
renewable4
faculty4
true4
settings4
msc4
design4
bachelor4
24
studies4
coursespostgraduate4
postgraduate4
orientals4
group4
oriental4
weavers4
computer4
committee4
council4
undergraduate4
include4
induction4
margin-top4
staff4
scientific4
visit4
documentgetelementbyidrs-plugin-settings-inline-css4
learning4
ifhtmldiv4
media4
documentcreateelementdiv4
documentgetelementsbytagnamehead0appendchildhtmldivchildnodes04
read4
more4
mr4
quality4
end4
make4
farid4
guide4
covid-194
background-color3
construction3
obituary3
revolution3
library3
well3
now3
annual3
33
body3
degree3
43
color3
slidestoscroll3
prevscrollposs3
slidestoshow3
top3
breakpoint3
meng3
js3
agreement3
53
petrochemicals3
plan3
guidance3
advanced3
industries3
virus3
corona3
industry3
develop3
projects3
their3
addition3
party3
products3
has3
institutions3
some3
foundation3
community3
you3
next3
partnership3
63
slider3

Who hosts Bue.edu.eg?

Bue.edu.eg Hosting Provider Information

Hosted IP Address:178.162.193.50
Hosted Hostname:178.162.193.50
Service Provider:Leaseweb Deutschland GmbH
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:nginx

Is "Leaseweb Deutschland GmbH" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%
Leaseweb Deutschland GmbH
0.0223%

HTTP Header Analysis for Bue.edu.eg

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Wed, 04 Nov 2020 08:16:23 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Frame-Options: SAMEORIGIN
Link:; rel=shortlink
X-TEC-API-VERSION: v1
X-TEC-API-ROOT: https://www.bue.edu.eg/wp-json/tribe/events/v1/
X-TEC-API-ORIGIN: https://www.bue.edu.eg
Content-Encoding: gzip

Bue.edu.eg Domain Nameserver Information

HostIP AddressCountry
frcu.eun.eg 193.227.1.1Egypt Egypt
ns2.bue.edu.eg 41.33.243.126Egypt Egypt


Need to find out who hosts Bue.edu.eg?


Domain Registration (WhoIs) information for Bue.edu.eg

 % This is the RIPE Database query service.
% The objects are in RPSL format.
%
% The RIPE Database is subject to Terms and Conditions.
% See http://www.ripe.net/db/support/db-terms-conditions.pdf

% Note: this output has been filtered.
% To receive output for a database update, use the "-B" flag.

%ERROR:101: no entries found
%
% No entries found in source RIPE.

% This query was served by the RIPE Database Query Service version 1.97.2 (BLAARKOP)

Websites with Similar Names

Bue-auren.com
bue-auren.com
Bue-glauser.ch
Ihr Lohnunternehmen im Oberaargau - Säen, Dreschen, Pressen, Maisernte, Pflanzenschutz, Vermietungen, Winterdienst, Werkstatt - Glauser Lohnunternehmen in Auswil vom Säen über Dreschen bis Pressen
Bue-groupe.com
BUE - Acceuil
Bue-net.dk
Netshop for Sejlere og Fiskere - Bue-Net.dk
Bue-tec.de
404 Not Found
Bue-zvmat.work
bue-zvmat.work
Bue.cc
就要折扣_91zk.cc_淘宝天猫店铺隐藏优惠券分享站!
Bue.com.tw
大愛心-居家看護中-醫院看護

Recently Updated Websites

Aquakingz.com (5 seconds ago.)Basscat.com (7 seconds ago.)Gz30.com (7 seconds ago.)Bmacpherson.com (8 seconds ago.)Lllupgrades.com (10 seconds ago.)Bluepride.org (11 seconds ago.)Fifatalents.com (12 seconds ago.)Arte-t.com (13 seconds ago.)Birminghamrecord.com (14 seconds ago.)Narutospot.me (15 seconds ago.)On-multiplesclerosis-ok.live (15 seconds ago.)Vestacaffe.com (16 seconds ago.)Totalwok.com (16 seconds ago.)Club-eye.com (16 seconds ago.)Efficaciouscbdoil.com (19 seconds ago.)Yvelines.fr (20 seconds ago.)Bijouware.com (23 seconds ago.)Qts.de (24 seconds ago.)Grantverstandigfoundation.net (26 seconds ago.)A-great-oil-change.zone (27 seconds ago.)003rt.ru (27 seconds ago.)Bobty92.com (29 seconds ago.)Maxwelltrianglerealty.com (30 seconds ago.)Ltcq3.com (31 seconds ago.)Lindsayapayne.com (32 seconds ago.)Farmasicouple.com (33 seconds ago.)Anupamamohan.digital (35 seconds ago.)Promzacondiesul.pro (35 seconds ago.)Ernstheating.com (35 seconds ago.)Worldwidecircuits.com (36 seconds ago.)

Recently Searched Keywords

top florida realtors (1 second ago.)私人短片 (1 second ago.)printed shorts (1 second ago.)heating oil (1 second ago.)al mismo (1 second ago.)menarik yang (1 second ago.)istri montok (2 seconds ago.)videosbag (2 seconds ago.)medicine mental (3 seconds ago.)fmmtitletextsticker span (3 seconds ago.)find a group (4 seconds ago.)6.0分 (4 seconds ago.)stores the interface (5 seconds ago.)purchase pro service (5 seconds ago.)filmywap 2020 (6 seconds ago.)stores the interface (6 seconds ago.)im khc (6 seconds ago.)escápula (7 seconds ago.)turkey (7 seconds ago.)csvjoinrnn (8 seconds ago.)--lnw2px--brdvar--color11--alpha-brd1transform-origincenter 1px (8 seconds ago.)endnote (9 seconds ago.)stem cell research parkinsons (9 seconds ago.)post guard assistant commandant recruitment 2021 (9 seconds ago.)2021-03-19t123238 (10 seconds ago.)toxic relationship (11 seconds ago.)target 5 gior hai aperto un e-commerce e vendi poco (12 seconds ago.)7vw (12 seconds ago.)wine ranges (13 seconds ago.)点睛营销平台 (13 seconds ago.)