Businessinsider.in Summary

Businessinsider.in  |  Get the latest news through Business Insider India on tech, finance, politics, strategy, life and entertainment.
Low trust score  | 
Business Insider India: Latest News on Tech, Careers & Jobs, Finance, Money, Politics, Life & Strategy


Businessinsider.in has a Low Trust Score, and a Statvoo Rank of C.

Businessinsider.in is hosted by TATA Communications formerly VSNL is Leading ISP in India.
Businessinsider.in has an IP Address of 223.165.27.31 and a hostname of 223.165.27.31.

The domain businessinsider.in was registered 7 years 1 month 2 weeks ago by , it was last modified 6 years 5 months 4 weeks ago and currently is set to expire 4 years 1 month 2 weeks ago.

It is the world's 11,398 most popular site among over 300 million websites.

Businessinsider.in has a total of 0 backlinks.

Businessinsider.in gets approximately 114,774 unique visitors a day and 926,478 pageviews per day.

Businessinsider.in has an estimated worth of $1334160.
An average daily income of approximately $1853, which is wroughly $56,362 per month.

Whois information for businessinsider.in

Full Whois Lookup for Businessinsider.in Whois Lookup

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only, and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

Domain ID:D6906467-AFIN
Domain Name:BUSINESSINSIDER.IN
Created On:01-Dec-2012 08:37:41 UTC
Last Updated On:02-Dec-2015 12:34:23 UTC
Expiration Date:01-Dec-2017 08:37:41 UTC
Sponsoring Registrar:GoDaddy.com, LLC (R101-AFIN)
Status:CLIENT DELETE PROHIBITED
Reason:
Status:CLIENT RENEW PROHIBITED
Reason:
Status:CLIENT TRANSFER PROHIBITED
Reason:
Status:CLIENT UPDATE PROHIBITED
Reason:
Registrant ID:CR139764107
Registrant Name:Julie Hansen
Registrant Organization:Business Insider Inc.
Registrant Street1:257 Park Avenue South
Registrant Street2:
Registrant Street3:
Registrant City:New York
Registrant State/Province:New York
Registrant Postal Code:10010
Registrant Country:US
Registrant Phone:+0.6463766030
Registrant Phone Ext.:
Registrant FAX:
Registrant FAX Ext.:
Registrant Login to show email
ID:CR139764115
Admin Name:Julie Hansen
Admin Organization:Business Insider Inc.
Admin Street1:257 Park Avenue South
Admin Street2:
Admin Street3:
Admin City:New York
Admin State/Province:New York
Admin Postal Code:10010
Admin Country:US
Admin Phone:+0.6463766030
Admin Phone Ext.:
Admin FAX:
Admin FAX Ext.:
Admin Login to show email
ID:CR139764111
Tech Name:Julie Hansen
Tech Organization:Business Insider Inc.
Tech Street1:257 Park Avenue South
Tech Street2:
Tech Street3:
Tech City:New York
Tech State/Province:New York
Tech Postal Code:10010
Tech Country:US
Tech Phone:+0.6463766030
Tech Phone Ext.:
Tech FAX:
Tech FAX Ext.:
Tech Login to show email
Server:PDNS1.ULTRADNS.NET
Name Server:PDNS2.ULTRADNS.NET
Name Server:PDNS3.ULTRADNS.ORG
Name Server:PDNS4.ULTRADNS.ORG
Name Server:PDNS5.ULTRADNS.INFO
Name Server:PDNS6.ULTRADNS.CO.UK
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned

Who hosts Businessinsider.in?

Businessinsider.in Web Server Information

Hosted IP Address:223.165.27.31
Hosted Hostname:223.165.27.31
Service Provider:TATA Communications formerly VSNL is Leading ISP
Hosted Country:IndiaIN
Location Latitude:20
Location Longitude:77
Webserver Software:Not Applicable

HTTP Header Analysis for Businessinsider.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache
CacheControl: public
Last-Modified: Mon, 08 Jun 2015 21:17:25 GMT
Content-Language: en-US
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 25282
Content-Type: text/html;charset=UTF-8
Expires: Mon, 08 Jun 2015 21:27:25 GMT
Date: Mon, 08 Jun 2015 21:19:25 GMT
Connection: keep-alive

Need to find out who hosts Businessinsider.in?

Businessinsider.in Free SEO Report

Website Inpage Analysis for Businessinsider.in

H1 Headings:1
.cls-1, .cls-2 { fill: #185f7d; } .cls-2 { fill-rule: evenodd; } .cls-3 { fill: #67c2e5; }
H2 Headings:13
The iconic Bajaj Chetak makes a grand e-comeback with a price tag of over ₹1 lakh
Wipro's profit and margin fall even as its digital business grows
Army Day 2020: Why does India celebrate Army Day on January 15
Budget 2020: Auto industry expectations range from GST cuts to another EV boost
This Sankranti, fly your kites on PUBG Mobile to earn tokens and roll the dice
IndusInd Bank stock falls 3.9% as its net profit grows by 33%
Bezos’ India visit and a billion-dollar business ⁠— many reasons why Microsoft may have had to retract Satya Nadella’s statement on India’s new citizenship law
Nine people killed by avalanches in Jammu and Kashmir
Thousands of angry Indians are planning to disrupt a visit from Jeff Bezos by staging mass protests over Amazon's disruption of retail
Satya Nadella answers call to speak on CAA, 'I think what’s happening is sad. It’s just bad.'
Delhi 2020 Election: Sadar Bazaar, a constituency which is a ruling party bastion, is all set for a triangular contest
Prices of food and essentials to rise further as wholesale inflation is at 7-month high
A 79-year iconic scooter brand is taking an electric avatar - but it will not be called Bajaj
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:198
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Businessinsider.in

p heightborder 05position1px solid dddperfectfunction otabparyoull43media maxwidth 1024px18px fontweighttraveling beerdrinkers herefoodprincess12div paddingbottomwant to retiredivfirstchildpaddingleft 0px floatmaxwidth1920pxits websiteheight auto heightmake citieswebkitboxorient verticalcolor 000fontsizediv a divfirstchildpaddingleftinfosys citing maliciouslineheightwebkitlineclamp 3webkitboxorient verticalfontsizeworkingdddrevealsdiv spanhilarious map showsh3fontsize 20pxmedia maxwidth640pxhiddenwins0px floatauto height 18pxfaktconprosemiboldfaktconprobdboldrobotomarginfontstyle000fontsize65 years fiveoffer butnormalfaktconprosemiboldfaktconprobdboldroboto condensedsansserifstxlyudod div h3fontsizevar coldetect varwidth 100hitmanspresidenttravelingwidth 100 borderbottombusiness50paddingleft 43floatimportant paddingbottom 0kalanick lastedimportant widthneed seriousbeerdrinkersactuallydiv h3maxheightoutmaxheight 117px overflowmargintop 18px width45focus on ifbecomemalicious baselessh3maxheight 68pxmediatroops clashingjon snow has0citiescountlessotabpar elseiftypeof canrunthey45float leftpaddingright 5media68pxmedia maxwidthbeerdrinkers hereheresyou burncalories you burnhasrolefinally buyrole for 65biggestimportant width 45important maxheightshowsprogramhave missedbackgroundrepeatstonesmade duringxnyohd div h3fontsize3videosmaxwidth 1024pxanotherhome29px lineheight 18pxlastedhisprincess diana wentstartwebkitlineclamp 1 webkitboxorientdiv h3seeweekend box officebodyguard winsbaseless personalimportant maxheight 18pxofficeddd paddingdisplay webkitbox webkitlineclampimportantmarginbottom 0has traveled compareddisplaykalanickwebsite that youimg float0 color0px float leftwebkitboxwebkitlineclamp 2 webkitboxorient5px 0 0heightundefined canruncanrun undefined canrunmanelseiftypeof186 importantmaxheight10pxpaddingright5div h3 paddingleftpaddingright 5media45floatcouldcharlottesville responsequit google0height autofloatcomparedfontweight 400 fontstylemaxheight 117pxdetails you15daily routinepaddingbottom 0 importantmarginbottomeditorialdivfirstchildpaddingleft 0pxlist100 borderbottom 1pxinto000fontsize 15pxlineheightepisodejobnavy destroyer collided160 importantmaxheightright nowhiddendisplay webkitboxwebkitlineclampitsfontweight0 0 heightdiv ppaddingtopborder 0 importantcoastcanrun undefinedhidden displaypanda nanniesyet another offersikkarightfloat rightborderbottomppaddingtopnormal widthrsbackgroundrepeat norepeatbackgroundpositionimportant displayalongwebkitboxwebkitlineclamp 2womanborderbottom 1px solid190 faktconprosemiboldfaktconprobdboldroboto condensedsansserifambani madetraveling beerdrinkershighbaseless999verticalalignoverflow hidden50width 45float leftpaddingrightmillennials are killingbeensnowmaxwidthknowbuy a homecalories youbill gatesundefinedpoints mukesh ambani85pxmedia maxwidth18px width45var5position relativemedia maxwidth1920pxh3fontsize 186 importantmediamarketpointsdisplay block floatwebkitlineclampofferfatherleft widthwebkitboxorientfontheightcanrundiv h3fontsize15pxmedia43mediah3maxheightfocuspeoplejon snowwebkitboxorient verticalcolorsnow haspaydiv h3maxheight 85pxmediawidth100floatbottom rightfloat rightdiv h3fontsize 186condensedsansserif marginwidth 100 floatyears five timesfive timesnew42pxoverflow hiddendisplay webkitboxwebkitlineclampcaloriesnumber40 marginright43float leftpaddingrightjonsalarydiv p width60pxmediaweekendquitdivfirstchildwidth 40fontstyle normal widthwidth 50paddingleft 43floatautomedia maxwidth840pxcharlottesvilleciting maliciousdifferent18px important maxheightscarred11px20pxmediah3fontsize 186startupcantreatmentseclipse will makeverticalcolorxnyohd0 height autotraveledtitlelength60titlelengthpdtitleadexpensivecoldetect vardiv borderblockdiv paddingbottom 0stxlyudod div18px important overflowbelievesmaliciouslike18px importantboxwidthtrumpslistinggoogle the culturecalculate the numberautooffhere are 9another offercultureambani made during3webkitboxorient verticalfontsizenormal width 100years five3webkitboxorient verticalfontsize 29pxduringundefined typeof canruneclipseroutine of billionairedark as othertrumps charlottesville responsememinwidth0 importantmaxwidth 770pxtriedfargates who loves75pxmediagetmargin 0get a job19websitehis roleciting malicious baseless0 important paddingbottomauto maxheightbogus here400 fontstyle normalmissedmaxheight 18px importantppaddingtop 19pxpaddingleft 50widthdetailsmay havecanrun undefined typeofmoregotsoepisode 6webkitlineclamp 1fontweight 400wellness treatmentsscarred millennialsnone cursorlovesgoogleleftmaxheightpadding 5pxdoing anythingthings you needmightburn doing anythingsolid ddd paddingheight 18px8xbox everppaddingtop 19pxpaddinglefttime around itspersonalbottom18tourismyou neednextcrucialhid a jobsikka leaves infosysventures believespandawidth100float lefttextdecoration nonehome rightother planetshitmans bodyguard winsleft font normalnyuajfbqdv divcoldetectonly 3 things50widthwebkitboxorient verticalclearxnyohd divlefttextdecoration none cursornorepeatbackgroundposition bottom rightfloatearn to buyelseiftypeof canruntheirh3maxheight 68pxmedia maxwidthduring launchingleftlineheight 22pxbackgroundimageurlhttpwwwbusinessinsiderinbimedcommonsimagescolombiaicongraypng backgroundrepeatoverflow hidden displayimportantmaxheight 60pxmediaif you wantamppaddingbottom 045 marginrightaroundroutinelefttextdecorationsalary youmarginright 319pxpaddinglefttravisbillglobalcan finally buy0pxhitmans bodyguardearnheight automedia maxwidth840px50width 45floathiddendisplay webkitboxwebkitlineclamp 2woman who quitonline13186 importantmedia maxwidth767px1ptraveled compared6h3maxheight 75pxmediadiv ppaddingtop 19pxpaddingleftifh3fontsize26pxmaxheight1px solidmarginright 5position relativemediaarunif youujlqwos divneed to earnanother offer butrightscollidedindiaindia herersquoswentlefttextdecoration noneworldmost powerfulsnow has traveledtopjustvar htmld1 titlelength60titlelengthpdtitleadleaves infosys citingpadding 5px 0made the 500customer42pxoverflow hiddendisplaywidth100float lefttextdecorationdianaheight auto floatentrepreneurssolidnavycolor 999verticalalign 10pxpaddingright5editorial boardverticalcolor 000fontsizeh3itqeiqq div160 importantmaxheight 52pxnow in 23merchant vessel off186 importantmediafunction43floatwebkitboxorient verticalclear leftlineheightfloat left fontleaves infosysh3 fontsize 160things to knowtypeof canrunblock floatdiv a width100floatjobsinsidejob listingtime0heightheight auto maxheightrelativemedia maxwidth1920pxambanih3maxheight 85pxmediadiv a divout with yetbutbuyciting160 importantmaxheight 60pxmediadiv a imgyet another0 importantmarginbottom 0fontsize 160 importantmaxheightfloat left widthboardhtmld1190 faktconprosemiboldfaktconprobdboldrobototroops0 0normal 190 faktconprosemiboldfaktconprobdboldrobotoever madeheight automake11keymukesh ambani madeworldsneed to dorightfloat right margintopdiv h3fontsize 20pxmediaotherspanwebkitbox webkitlineclamp 1know beforewebkitlineclamp 3webkitboxorientyou wantvar coldetect43float leftpaddingright 6mediamaxwidth840pxdiv h3fontsize26pxmaxheightindian troops clashingwebkitbox webkitlineclamp 3webkitboxorientmap showsthings youbogusauto float leftwebkitbox webkitlineclampdiv a divnthchild2widthcalc100travis kalanickleftpaddingrightyouvesseldorips intotime around50paddingleft 43float leftpaddingrightboard rips intowidth45 fontsize 11pxh3fontsize15pxmedia7width45 fontsizedisplay webkitboxseriousonly 3clashing16color 999verticalalignxbox ever madedreambillionairelineheight 18px fontweight6mediaverticalclear leftlineheight 22pxbackgroundimageurlhttpwwwbusinessinsiderinbimedcommonsimagescolombiaicongraypngleft width 10011px color 999verticalalign999verticalalign 10pxpaddingright5millennialshelpleftbrandpdfunctionddd padding 5var htmld1verticalfontsize 29px lineheighttypeofspan paddingnannies to travelingcanrun windowopenparselfelsewindowopenparblankshouldsanright margintop 18pxplanetsdiv span paddingaround itsleft bordermap15pxlineheightknow before adoptingdivnthchild2widthcalc100 43mediawidth 45 marginrightfar jonyou need seriouspadding 0margintop 18pxceomarginright0 important displayimportantmarginbottomretiredivfirstchildwidth 40 marginright0 important widthunmanageable la timesbillionaire billautofloath3fontsize 20pxmediadestroyer collided100 float22pxbackgroundimageurlhttpwwwbusinessinsiderinbimedcommonsimagescolombiaicongraypng backgroundrepeatimportant paddingbottomfont normal normalnumber of calorieswouldimgclashing with stonesmerchant vesselwidth 50paddingleftproductsdo to getnormal normalyou can18px fontweight 4000 0heightkillingfather of androidcoldetect var htmld12 webkitboxorientvessel off18px width45 fontsizemost expensivepowerful xboxwellnessbordertrumps charlottesvilledailyh3 fontsizewantsikka leavesborderbottom 1pxmoney117pxprincess dianawhichyou burn doingonlydoingmargintopfloat left border29px lineheightthingsfinallydivnthchild2widthcalc100typeof canrun undefinedverticalclear leftlineheightbut this timenonethese0 0 0best3 thingsanything50paddingleftfiveundefined typeof770pxfontsize 11pxnyuajfbqdv div h3fontsizeresponsebudget68pxmedia maxwidth 770pxshows how far770px and minwidthsincemadeheight 18px importantcondensedsansserif margin 0maxheight 18pxxboxh3 paddingadoptingdiana wentdiv h3 fontsizelookimportantmedia maxwidth767pxwebkitboxgallerynewtimes editorialundefined canrun windowopenparselfelsewindowopenparblankfontsize 160hiddendisplaypaddingmarginright 5positionleft border 0otab function otabpar1pxcrucial points mukeshonethere is reallyyoursalary you needburn doingh3maxheight 75pxmedia maxwidthweekend boxafter0 importantmarginbottommuchimportantmediaheremade during launchingautofloat leftmaxheight 42pxoverflowmukesh ambaniimportantmaxheightupripscities as darkwindowonloaddiv height9treatments are bogusoverflowauto heightleavesfaktconprosemiboldfaktconprobdboldroboto condensedsansserif marginnavy destroyerbitcoinunmanageableburn19pxpaddingleft 50width 45floatfontstyle normalimportant overflowleftlineheighthilariouschineseverticalfontsizecursorfontsize 11px color45 marginright 5positionright margintopnowventuresh3maxheight 85pxmedia maxwidth20pxmedia maxwidth640pxpowerfulvideo14solar65 yearsstones highauto maxheight 117px9 dreamimportantmarginbottom 0 importanthome right nowyetbransonmaxheightitqeiqq div h3fontsizeimg float leftmargin 0 colorcrucial pointsnyuajfbqdvfirstsolid dddleft fontcompaniesrelativemedialazy weekenddarkloadchartbeatbodyguardp width 50paddingleftseemsdiv border 0iftypeofhilarious mapdivfirstchildpaddingleftpwyenrigleftpaddingright 6media5position relativemedianeedrightleftmaxheight 42pxoverflowp height autolineheight 18pxhtmld1 titlelength60titlelengthpdtitlead brandpdfunctionbox officewins a lazylazy weekend box5mediaotab functionbuyingnormal normal 19052pxdestroyer85pxmedia0 heightwindowopenparselfelsewindowopenparblankdivfirstchildwidthelseiftypeof canrun undefined18px5px 0thereeditorial board rips10universitynormal 190aheadusnorepeatbackgroundpositionp width19pxpaddingleft 50widthblock float left22pxbackgroundimageurlhttpwwwbusinessinsiderinbimedcommonsimagescolombiaicongraypngover41 webkitboxorient verticalclearleftlineheight 22pxbackgroundimageurlhttpwwwbusinessinsiderinbimedcommonsimagescolombiaicongraypngplansdiv h3fontsizeonesoff the coastgameleftpaddingright 6media maxwidthautomedia43media maxwidthcolormayiftypeof otabverticalfontsize 29pxhaveinfosys citingtimeswebkitboxwebkitlineclamplazyh3fontsize117px overflowpaddingbottom400 fontstylediv h3maxheight 68pxmedia11px coloryears40 marginright 3width 4568pxmedia1775pxmedia maxwidthautofloat leftmaxheight6media maxwidthreallyfunction otabpar elseiftypeofbottom rightfloatpwyenrig divhas traveledotabparvideos gallerynewdivdiv height automedia3 things youpadding 5need to focusinfosysmukeshlasted in hislisting on itsdisplay blockdiv pchinese and indianotabverticalcolor 000fontsize 15pxlineheightherersquosujlqwosboard ripspwyenrig div h3fontsize15pxmediashows chinese1024px and minwidthfloat leftallbackgroundrepeat norepeatbackgroundposition bottom5culture therebillionaire bill gateswidth45killing countlesshtmld1 titlelength60titlelengthpdtitleadnanniesfont normalverticalclearindian troops22pxbackgroundimageurlhttpwwwbusinessinsiderinbimedcommonsimagescolombiaicongraypng backgroundrepeat norepeatbackgroundpositionh3 padding 00height autofloat leftmaxheightlaunching29pxdiv h3maxheight 75pxmediaimportantmaxheight 52pxmaxwidth767pxlooksfar jon snowpushh3fontsize 186 importantmaxheightpoints mukeshbuy the most1 webkitboxorient2important100 float leftbefore adoptingtop 102 webkitboxorient verticalcolormostandroid42pxoverflowcondensedsansserifrightfloatever45float leftpaddingrightmalicious baseless personalspan padding 5pxcalculatehidden display webkitboxmost powerful xbox0 0height autofloatdiv p height3webkitboxorientmerchantauto floateveryday1024pxtimes editorial boardimportant overflow hiddenhidgoodindianinside lookgatescan finallyneed to knownorepeatbackgroundposition bottomsolar eclipsefloatfontsizebeforekindergartendivnthchild2widthcalc100 43media maxwidthheight automediapadding 0 0saysleftmaxheight 42pxoverflow hiddendisplaytitlelength60titlelengthpdtitlead brandpdfunctionotabpar elseiftypeof100 borderbottomwhite117px overflow hiddenstxlyudodiftypeof otab functiontakediv a divfirstchildwidthimportant display blockmaxwidth640pxitqeiqqujlqwos div h3fontsize5pxpowerful xbox ever

Longtail Keyword Density for Businessinsider.in

KeywordsOccurences
float left width16
div a div12
0 importantmargin-bottom 012
overflow hidden display12
hidden display -webkit-box11
display -webkit-box -webkit-line-clamp11
padding-bottom 0 importantmargin-bottom11
h3 font-size 16010
div h3font-size 18610
font-size 160 importantmax-height10
div h3 font-size10
border 0 important10
things you need9
div a divfirst-childpadding-left6
-webkit-line-clamp 1 -webkit-box-orient6
undefined canrun windowopenparselfelsewindowopenparblank6
div padding-bottom 06
rightfloat right margin-top6
undefined typeof canrun6
height auto max-height6
bottom rightfloat right6
div a width100float6
div height automedia6
img float left6
div a img6
width100float lefttext-decoration none6
lefttext-decoration none cursor6
0 0 06
padding 0 06
h3 padding 06
div h3 padding6
-webkit-box -webkit-line-clamp 16
18px important overflow6
htmld1 titlelength60titlelengthpdtitlead brandpdfunction6
var htmld1 titlelength60titlelengthpdtitlead6
coldetect var htmld16
var coldetect var6
iftypeof otab function6
otab function otabpar6
canrun undefined typeof6
elseiftypeof canrun undefined6
otabpar elseiftypeof canrun6
function otabpar elseiftypeof6
important overflow hidden6
canrun undefined canrun6
18px important max-height6
important max-height 18px6
max-height 18px important6
typeof canrun undefined6
height 18px important6
auto height 18px6
div p height6
p height auto6
height auto height6
font-size 11px color5
color 999vertical-align -10pxpadding-right55
11px color 999vertical-align5
0 0height autofloat5
autofloat leftmax-height 42pxoverflow5
leftmax-height 42pxoverflow hiddendisplay5
0height autofloat leftmax-height5
5px 0 0height5
span padding 5px5
padding 5px 05
div span padding5
22pxbackground-imageurlhttpwwwbusinessinsiderinbimedcommonsimagescolombia-icon-graypng background-repeat no-repeatbackground-position5
-webkit-box-orient verticalclear leftline-height5
verticalclear leftline-height 22pxbackground-imageurlhttpwwwbusinessinsiderinbimedcommonsimagescolombia-icon-graypng5
1 -webkit-box-orient verticalclear5
margin 0 color5
faktconprosemiboldfaktconprobdboldroboto condensedsans-serif margin5
condensedsans-serif margin 05
42pxoverflow hiddendisplay -webkit-box-webkit-line-clamp5
leftline-height 22pxbackground-imageurlhttpwwwbusinessinsiderinbimedcommonsimagescolombia-icon-graypng background-repeat5
margin-top -18px width455
-18px width45 font-size5
right margin-top -18px5
no-repeatbackground-position bottom rightfloat5
background-repeat no-repeatbackground-position bottom5
width45 font-size 11px5
important display block5
h3max-height 75pxmedia max-width5
div h3max-height 75pxmedia5
div h3max-height 68pxmedia5
h3max-height 68pxmedia max-width5
770px and min-width5
68pxmedia max-width 770px5
h3max-height 85pxmedia max-width5
div h3max-height 85pxmedia5
width 50padding-left 43float5
p width 50padding-left5
50padding-left 43float leftpadding-right5
43float leftpadding-right 6media5
leftpadding-right 6media max-width5
div a divfirst-childwidth5
divfirst-childwidth 40 margin-right5
50width 45float leftpadding-right5
19pxpadding-left 50width 45float5
45float leftpadding-right 5media5
160 importantmax-height 60pxmedia5
160 importantmax-height 52px5
ppadding-top 19pxpadding-left 50width5
div ppadding-top 19pxpadding-left5
div a divnth-child2widthcalc1005
40 margin-right 35
divnth-child2widthcalc100 43media max-width5
43media max-width 1024px5
1024px and min-width5
div p width5
h3font-size 186 importantmax-height5
0 important display5
importantmargin-bottom 0 important5
190 faktconprosemiboldfaktconprobdboldroboto condensedsans-serif5
display block float5
divfirst-childpadding-left 0px float5
block float left5
important padding-bottom 05
0 important padding-bottom5
2 -webkit-box-orient verticalcolor5
-webkit-box-webkit-line-clamp 2 -webkit-box-orient5
-webkit-box-orient verticalcolor 000font-size5
verticalcolor 000font-size 15pxline-height5
div border 05
0px float left5
float left border5
div h3font-size 20pxmedia5
height automedia max-width840px5
h3font-size 20pxmedia max-width640px5
h3font-size 186 importantmedia5
186 importantmedia max-width767px5
5position relativemedia max-width1920px5
margin-right 5position relativemedia5
0 important width5
left border 05
important width 455
width 45 margin-right5
45 margin-right 5position5
hiddendisplay -webkit-box-webkit-line-clamp 25
100 float left5
0 height auto5
0 0 height5
ddd padding 55
auto max-height 117px5
max-height 117px overflow5
-webkit-box -webkit-line-clamp 3-webkit-box-orient5
117px overflow hidden5
solid ddd padding5
1px solid ddd5
height auto float5
normal 190 faktconprosemiboldfaktconprobdboldroboto5
auto float left5
left width 1005
border-bottom 1px solid5
width 100 border-bottom5
-webkit-line-clamp 3-webkit-box-orient verticalfont-size5
100 border-bottom 1px5
normal normal 1905
width 100 float5
3-webkit-box-orient verticalfont-size 29px5
float left font5
font normal normal5
left font normal5
normal width 1005
font-style normal width5
29px line-height 18px5
verticalfont-size 29px line-height5
line-height 18px font-weight5
18px font-weight 4005
400 font-style normal5
font-weight 400 font-style5
traveling beer-drinkers here4
nannies to traveling4
here are 94
pwyenrig div h3font-size15pxmedia4
princess diana went4
get a job3
can finally buy3
buy the most3
made during launching3
ambani made during3
crucial points mukesh3
points mukesh ambani3
mukesh ambani made3
most powerful xbox3
xbox ever made3
burn doing anything3
eclipse will make3
cities as dark3
you burn doing3
calories you burn3
made the 5003
calculate the number3
number of calories3
powerful xbox ever3
you need serious3
dark as other3
website that you3
woman who quit3
google the culture3
there is really3
listing on its3
xnyohd div h3font-size3
itqeiqq div h3font-size3
nyuajfbqdv div h3font-size3
stxlyudod div h3font-size3
father of android3
only 3 things3
3 things you3
another offer but3
but this time3
time around its3
need to do3
yet another offer3
out with yet3
need to focus3
focus on if3
if you want3
want to retire3
do to get3
need to earn3
billionaire bill gates3
gates who loves3
need to know3
millennials are killing3
routine of billionaire3
clashing with stones3
merchant vessel off3
off the coast3
chinese and indian3
indian troops clashing3
hitmans bodyguard wins3
wins a lazy3
jon snow has3
snow has traveled3
has traveled compared3
hid a job3
far jon snow3
shows how far3
lazy weekend box3
weekend box office3
hilarious map shows3
navy destroyer collided3
trumps charlottesville response3
sikka leaves infosys3
ujlqwos div h3font-size3
leaves infosys citing3
infosys citing malicious3
know before adopting3
things to know3
lasted in his3
role for 653
65 years five3
years five times3
citing malicious baseless3
malicious baseless personal3
unmanageable la times3
times editorial board3
editorial board rips3
board rips into3
now in 233
home right now3
salary you need3
earn to buy3
buy a home3
treatments are bogus3
float left26
height auto17
div h316
left width16
you need16
0 important15
div h3font-size15
div h3max-height15
0 013
importantmargin-bottom 012
hidden display12
overflow hidden12
0 importantmargin-bottom12
18px important12
canrun undefined12
div p11
border 011
-webkit-box -webkit-line-clamp11
display -webkit-box11
width 10011
padding-bottom 011
font-size 16010
h3 font-size10
160 importantmax-height10
h3font-size 18610
things you9
auto max-height6
bottom rightfloat6
none cursor6
rightfloat right6
right margin-top6
height automedia6
div height6
div padding-bottom6
img float6
h3 padding6
lefttext-decoration none6
width100float lefttext-decoration6
padding 06
-webkit-line-clamp 16
elseiftypeof canrun6
undefined typeof6
otabpar elseiftypeof6
function otabpar6
otab function6
typeof canrun6
undefined canrun6
pwyenrig div6
p height6
auto height6
canrun windowopenparselfelsewindowopenparblank6
1 -webkit-box-orient6
iftypeof otab6
titlelength60titlelengthpdtitlead brandpdfunction6
max-height 18px6
important overflow6
height 18px6
important max-height6
htmld1 titlelength60titlelengthpdtitlead6
var coldetect6
var htmld16
coldetect var6
div span5
color 999vertical-align5
999vertical-align -10pxpadding-right55
span padding5
0 0height5
leftmax-height 42pxoverflow5
42pxoverflow hiddendisplay5
autofloat leftmax-height5
0height autofloat5
5px 05
padding 5px5
no-repeatbackground-position bottom5
verticalclear leftline-height5
leftline-height 22pxbackground-imageurlhttpwwwbusinessinsiderinbimedcommonsimagescolombia-icon-graypng5
-webkit-box-orient verticalclear5
0 color5
margin 05
22pxbackground-imageurlhttpwwwbusinessinsiderinbimedcommonsimagescolombia-icon-graypng background-repeat5
background-repeat no-repeatbackground-position5
width45 font-size5
font-size 11px5
-18px width455
margin-top -18px5
hiddendisplay -webkit-box-webkit-line-clamp5
11px color5
left border5
max-width 770px5
68pxmedia max-width5
divfirst-childwidth 405
40 margin-right5
divnth-child2widthcalc100 43media5
margin-right 35
h3max-height 68pxmedia5
75pxmedia max-width5
6media max-width5
leftpadding-right 6media5
h3max-height 85pxmedia5
85pxmedia max-width5
h3max-height 75pxmedia5
43media max-width5
max-width 1024px5
xnyohd div5
importantmax-height 52px5
stxlyudod div5
nyuajfbqdv div5
videos gallerynew5
itqeiqq div5
importantmax-height 60pxmedia5
leftpadding-right 5media5
ppadding-top 19pxpadding-left5
div ppadding-top5
19pxpadding-left 50width5
50width 45float5
45float leftpadding-right5
43float leftpadding-right5
50padding-left 43float5
block float5
display block5
divfirst-childpadding-left 0px5
0px float5
important width5
condensedsans-serif margin5
important display5
important padding-bottom5
-webkit-box-orient verticalcolor5
2 -webkit-box-orient5
verticalcolor 000font-size5
000font-size 15pxline-height5
div border5
width 455
45 margin-right5
186 importantmedia5
20pxmedia max-width640px5
importantmedia max-width767px5
186 importantmax-height5
width 50padding-left5
p width5
h3font-size 20pxmedia5
automedia max-width840px5
5position relativemedia5
margin-right 5position5
relativemedia max-width1920px5
ujlqwos div5
div h3font-size26pxmax-height5
-webkit-box-webkit-line-clamp 25
18px font-weight5
0 height5
padding 55
max-height 117px5
117px overflow5
3-webkit-box-orient verticalfont-size5
-webkit-line-clamp 3-webkit-box-orient5
ddd padding5
solid ddd5
faktconprosemiboldfaktconprobdboldroboto condensedsans-serif5
right now5
auto float5
border-bottom 1px5
1px solid5
verticalfont-size 29px5
100 border-bottom5
normal normal5
font normal5
190 faktconprosemiboldfaktconprobdboldroboto5
normal 1905
29px line-height5
left font5
100 float5
line-height 18px5
font-weight 4005
400 font-style5
normal width5
font-style normal5
diana went4
inside look4
have missed4
details you4
princess diana4
panda nannies4
9 dream4
div h3font-size15pxmedia4
beer-drinkers here4
traveling beer-drinkers4
ever made3
xbox ever3
finally buy3
most powerful3
powerful xbox3
kalanick lasted3
calories you3
burn doing3
other planets3
wellness treatments3
make cities3
solar eclipse3
bogus here3
doing anything3
you burn3
another offer3
3 things3
if you3
you want3
yet another3
only 33
culture there3
its website3
need serious3
ventures believes3
quit google3
his role3
offer but3
made during3
during launching3
india herersquos3
episode 63
ambani made3
mukesh ambani3
time around3
around its3
crucial points3
points mukesh3
can finally3
home right3
killing countless3
scarred millennials3
most expensive3
travis kalanick3
hitmans bodyguard3
bill gates3
billionaire bill3
indian troops3
troops clashing3
stones high3
daily routine3
bodyguard wins3
lazy weekend3
snow has3
has traveled3
traveled compared3
job listing3
jon snow3
far jon3
weekend box3
box office3
hilarious map3
map shows3
shows chinese3
vessel off3
citing malicious3
infosys citing3
malicious baseless3
baseless personal3
you can3
leaves infosys3
sikka leaves3
years five3
five times3
know before3
before adopting3
top 103
salary you3
charlottesville response3
navy destroyer3
destroyer collided3
merchant vessel3
trumps charlottesville3
rips into3
may have3
times editorial3
editorial board3
board rips3
65 years3
div142
066
you42
width33
height29
important28
float27
left27
max-width25
auto18
canrun18
var17
p17
18px17
display17
need17
h316
padding16
h3max-height15
font-size15
normal15
importantmax-height15
h3font-size15
have14
its14
right13
border13
india12
hidden12
overflow12
undefined12
most12
here12
112
function12
things12
made12
importantmargin-bottom12
color12
max-height12
-webkit-line-clamp11
-webkit-box11
padding-bottom11
his11
-webkit-box-orient11
211
min-width10
310
410
margin-right10
510
leftpadding-right10
make9
has9
job9
look9
indian8
new8
now8
into8
amp8
us8
get8
know8
times8
budget8
68
their8
77
game7
out7
87
pwyenrig7
herersquos7
gallerynew7
first7
up7
typeof7
business7
line-height7
max-width1920px6
importantmedia6
top6
shows6
kalanick6
max-width640px6
bottom6
help6
margin-top6
automedia6
inside6
background-repeat6
-webkit-box-webkit-line-clamp6
divfirst-childpadding-left6
rightfloat6
coldetect6
buy6
xnyohd6
points6
stxlyudod6
all6
htmld16
96
your6
106
over6
jobs6
ujlqwos6
width100float6
lefttext-decoration6
none6
cursor6
img6
if6
nyuajfbqdv6
around6
itqeiqq6
elseiftypeof6
windowopenparselfelsewindowopenparblank6
otab6
otabpar6
iftypeof6
max-width840px6
titlelength60titlelengthpdtitlead6
can6
brandpdfunction6
115
5position5
0px5
22pxbackground-imageurlhttpwwwbusinessinsiderinbimedcommonsimagescolombia-icon-graypng5
block5
125
leftline-height5
verticalclear5
1px5
faktconprosemiboldfaktconprobdboldroboto5
h3font-size26pxmax-height5
condensedsans-serif5
margin5
ddd5
solid5
border-bottom5
font5
best5
relativemedia5
they5
span5
5px5
29px5
verticalfont-size5
-10pxpadding-right55
999vertical-align5
-18px5
width455
135
11px5
no-repeatbackground-position5
expensive5
font-style5
verticalcolor5
000font-size5
15pxline-height5
hiddendisplay5
42pxoverflow5
0height5
autofloat5
3-webkit-box-orient5
leftmax-height5
font-weight5
770px5
50width5
19pxpadding-left5
45float5
cities5
60pxmedia5
ppadding-top5
1024px5
117px5
divfirst-childwidth5
divnth-child2widthcalc1005
43media5
52px5
ceo5
startup5
only5
really5
videos5
yet5
like5
xbox5
finally5
much5
man5
68pxmedia5
5media5
43float5
75pxmedia5
85pxmedia5
20pxmedia5
max-width767px5
50padding-left5
see5
president5
says5
branson5
6media5
pay4
personal4
tourism4
push4
map4
android4
one4
do4
online4
h3font-size15pxmedia4
there4
google4
quit4
worlds4
woman4
home4
these4
but4
details4
might4
plans4
focus4
bitcoin4
become4
companies4
princess4
missed4
years4
should4
chinese4
144
beer-drinkers4
nannies4
kindergarten4
went4
diana4
traveling4
dream4
people4
ever4
reveals4
biggest4
episode4
panda4
sikka4
154
other4
before4
video4
white4
loadchartbeat3
windowonload3
actually3
products3
father3
along3
youll3
money3
ventures3
start3
san3
believes3
coast3
wellness3
planets3
treatments3
bogus3
after3
ones3
dark3
eclipse3
calories3
number3
burn3
doing3
solar3
anything3
heres3
lasted3
leaves3
adopting3
infosys3
citing3
baseless3
malicious3
buying3
since3
163
role3
five3
key3
program3
been3
calculate3
173
customer3
next3
another3
offer3
everyday3
time3
ahead3
retire3
listing3
hid3
website3
serious3
want3
culture3
rs3
could3
arun3
global3
just3
so3
powerful3
183
got3
launching3
crucial3
looks3
mukesh3
ambani3
during3
entrepreneurs3
would3
killing3
millennials3
countless3
food3
hitmans3
travis3
scarred3
tried3
bill3
billionaire3
gates3
loves3
good3
seems3
bodyguard3
wins3
traveled3
snow3
compared3
perfect3
which3
world3
jon3
far3
weekend3
lazy3
box3
office3
hilarious3
routine3
daily3
unmanageable3
market3
editorial3
board3
trumps3
rips3
may3
different3
take3
me3
salary3
earn3
working3
193
charlottesville3
response3
clashing3
troops3
stones3
high3
more3
rights3
off3
vessel3
navy3
university3
destroyer3
collided3
merchant3
list3

What are the nameservers for businessinsider.in?

Businessinsider.in Domain Nameserver Information

HostIP AddressCountry
pdns1.ultradns.net 204.74.108.1United States United States
pdns2.ultradns.net 204.74.109.1United States United States
pdns3.ultradns.org 199.7.68.1United States United States
pdns4.ultradns.org 199.7.69.1United States United States
pdns5.ultradns.info 204.74.114.1United States United States
pdns6.ultradns.co.uk 204.74.115.1United States United States

Businessinsider.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Businessinsider.in is a scam?