今周刊 - 在今天看見明天

Safety: High trust score
Year Founded: 2020
Global Traffic Rank: 4,814
Estimated Worth: $15,257,160
Category: This site has not been categorized yet

Businesstoday.com.tw is a subdomain of Com.tw

今周刊持續揭露第一手的財經資訊與產業動態。從國際趨勢、政治經濟情勢、產業動態到理財規劃及社會文化資訊。



Domain summary

Last updated
2020-10-25
Domain label
businesstoday
Domain extension
com.tw
Global Traffic Rank
4,814
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$15,257,160
Estimated daily income
$14,127
Estimated monthly income
$429,696

Frequently Asked Questions (FAQ)

Q: When was Businesstoday.com.tw registered?
A: Businesstoday.com.tw was registered 1 year, 7 months, 3 weeks, 5 days, 7 hours, 54 minutes, 55 seconds ago on Tuesday, January 28, 2020.
Q: When was the WHOIS for Businesstoday.com.tw last updated?
A: The WHOIS entry was last updated 1 year, 7 months, 3 weeks, 5 days, 7 hours, 54 minutes, 55 seconds ago on Tuesday, January 28, 2020.
Q: What are Businesstoday.com.tw's nameservers?
A: DNS for Businesstoday.com.tw is provided by the following nameservers:
  • ns-334.awsdns-41.com
  • ns-1861.awsdns-40.co.uk
  • ns-1239.awsdns-26.org
  • ns-873.awsdns-45.net
Q: Who is the registrar for the Businesstoday.com.tw domain?
A: The domain has been registered at .
Q: What is the traffic rank for Businesstoday.com.tw?
A: Businesstoday.com.tw ranks 4,814 globally on Alexa. Businesstoday.com.tw has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Businesstoday.com.tw each day?
A: Businesstoday.com.tw receives approximately 1,765,817 visitors and 14,126,536 page impressions per day.
Q: What IP address does Businesstoday.com.tw resolve to?
A: Businesstoday.com.tw resolves to the IPv4 address .
Q: In what country are Businesstoday.com.tw servers located in?
A: Businesstoday.com.tw has servers located in the .
Q: What webserver software does Businesstoday.com.tw use?
A: Businesstoday.com.tw is powered by webserver.
Q: Who hosts Businesstoday.com.tw?
A: Businesstoday.com.tw is hosted by in .
Q: How much is Businesstoday.com.tw worth?
A: Businesstoday.com.tw has an estimated worth of $15,257,160. An average daily income of approximately $14,127, which is roughly $429,696 per month.

Businesstoday.com.tw Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Businesstoday.com.tw Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Businesstoday.com.tw

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Businesstoday.com.tw

20201021 iphone12if type bfunctiongethttpbusinesstodaycomtwloadingcheckoutshoppingfunctionnewhtmlresponsestatusif msg1 vartrue locationhref hrefloadmarketprompttype loadingcartitemhtml iffunction response ifj j varifelse if responsestatusvar quantityjson async false1parseintnumberdatatype json asyncif responsestatusif msg true2idval varerrorslickcheckout functionsubscriptionidif typeofresponsestatus undefinedmodalstyledisplayconfirmalert responsemessage setunlockresponsegopagedetailvar msgtimeeelse iflocationhref href elseloadingcartitemhtml ifundefined if20201021responsemessagemsg trueautoplay true autoplayspeedelse loadmarketprompttype loadingcartitemhtmltrue locationhrefmsg true locationhrefdatatype jsonislockmsg confirm responsemessagehrefhref else alertvar nowindexsuccessurlngiftsnowindexactionurlbookidquantityvalshoppingfunction consolelogalert responsemessagealerttypeofpage undefinedajax url apishoppingaddsubscriptionsituationcasestimeoutif typeofpage undefinedcouponnumbererror function consolelogurl apishoppingaddsubscriptionhtmlnowindex jquantity 1 situationconfirm responsemessage ifshopping gethttpbusinesstodaycomtwloadingcheckoutshoppingfunctionnewhtml dataajaxshoppinghtmlnewhtml6 var1 windowlocationhref checkoutapishoppingaddsubscriptionsingleproductpage0customertokentimeout nullpostdatatruesuccess functionpageloadingcssdisplay changemarketitemtypecasesproductidquantitymarketidpagereplacehtmlvar jlocationreload else if3quantity quantityislock n islockif typeofresponsestatusresponsestatus 0pageloadingcssdisplaylocationreloaddata subscriptionid subscriptionidmsg confirmsingleproductpage alert windowlocationhrefelse if typeofpagepostalert windowlocationhref checkoutmodalelse alertresponsemessage getcustomerordertotal iffalsegetcustomerordertotal if responsestatussingleproductpage alertfunction response alertkeywordbvar quantity quantityvalvar j 0response alertvar customertokenif islock nelsevar marketidresponse if responsegopagedetailcustomertokenval ajax urlgetcustomerordertotalsetunlockcustomertokenval ajax1 situation listislock nconsolelog4islock n functionshopping gethttpbusinesstodaycomtwloadingcheckoutshoppingfunctionnewhtmlislock yerror functionloadingcartitemhtml if typechangemarketitemtypecasesproductidquantitymarketidpageif type cundefined page shoppingundefined page singleproductpagey var msgif caseslatestfinancelastcountlatestnewscountsetunlock elsefalse error0 islock nif responsegopagedetail y0 alertapishoppingaddsubscription type postwindowlocationhref checkoutwindowlocationhrefresponsemessage getcustomerordertotalgetcustomerordertotal iftypealert windowlocationhrefpresentidfunction consolelog successdotssituation listtypeofresponsestatusresponsegopagedetail y varresponsemessage setunlock ifvar customertoken customertokenval1 situationtypeofresponsestatus undefined ifautoplayspeed 5000 arrowstype postcases checkoutfalse error functioncheckoutlatestfinancecountif responsestatus 1responsestatus 1 setunlockresponsemessage if msgtype cgethttpbusinesstodaycomtwloadingcheckoutshoppingfunctionnewhtml dataajaxshoppinghtmlnewhtmlpost data subscriptionidvarj i 6responsestatus 1 windowlocationhrefpost dataquantity quantityvalif typeofpage5000 arrows trueif typeconfirm responsemessagetrue dotsvar i 0cn islock yundefined pageautoplaytypeofpage undefined pagemsgproductidloadmarketprompttype loadingcartitemhtmlj varvar nowindex jnullj var nowindex5else alert responsemessagen islockwindowlocationhref checkout elseresponsegopagedetail ylocationhref hrefloadingcartitemhtmlridundefined if responsestatusn functionpage singleproductpage alertpage shoppingtrue autoplayspeed 5000islock y vargethttpbusinesstodaycomtwloadingcheckoutshoppingfunctionnewhtml dataajaxshoppinghtmlnewhtml elsecustomertokenvaljson asyncautoplayspeeddataajaxshoppinghtmlnewhtml else0 islockundefinedjtype btrue autoplayspeeddata subscriptionid1 setunlocksetunlock else ifsingledatavar postdataresponsesuccess function responseresponse ifwindowlocationhref checkout functiony varresponsemessage setunlockarrows true dotsloadmarketprompttypeautoplayspeed 5000consolelog success functionpage singleproductpageif responsegopagedetailconsolelog successj jsituation list datatypequantity 1marketid1 windowlocationhrefsubscriptionid quantityvlist datatypehref elsej 0androidlectureid1 setunlock else6 htmlasync false errorlocationhrefsetunlock if typeofpageidvallatestnewslastcountresponse alert responsemessagetypeofpage5000 arrowsasync falseresponsestatus 0 alertpage shopping gethttpbusinesstodaycomtwloadingcheckoutshoppingfunctionnewhtmlsubscriptionid subscriptionid quantityresponsemessage ifif islockjsontype post datapagecheckout elsefunction responsechangemarketitemtypecasesproductidquantitymarketidpage functionapishoppingaddsubscription typeajaxsituation singlecustomertoken customertokenvalbehaviorquantityautoplay trueurl apishoppingaddsubscription typealert responsemessage getcustomerordertotalvar msg confirmif responsestatus 0locationreload elselistif cases checkoutysubscriptionid subscriptionidsubscriptionid quantity 1responsestatus 1arrows0 alert responsemessageelse loadmarketprompttypearrows trueelse if typemobileflagiphone12ajax urlcustomertoken customertokenval ajaxcheckout else loadmarketprompttypepageloadingcssdisplay changemarketitemtypecasesproductidquantitymarketidpage functionsetunlock ifdatatypedataajaxshoppinghtmlnewhtml else ifasyncdataajaxshoppinghtmlnewhtmltypeofresponsestatus undefinedlist datatype json

Longtail Keyword Density for Businesstoday.com.tw

KeywordsOccurences
if responsestatus 116
success function response11
false error function9
json async false9
datatype json async9
async false error9
type post data8
else if responsestatus8
function consolelog success8
error function consolelog8
alert responsemessage getcustomerordertotal8
responsemessage getcustomerordertotal if8
getcustomerordertotal if responsestatus8
responsestatus 1 windowlocationhref8
if responsestatus 08
consolelog success function8
if typeofresponsestatus undefined8
if typeofpage undefined7
var i 07
typeofpage undefined page7
typeofresponsestatus undefined if6
windowlocationhref checkout function6
if islock n6
1 windowlocationhref checkout6
0 alert responsemessage6
responsestatus 0 alert6
undefined if responsestatus6
post data subscriptionid5
else if type5
data subscriptionid subscriptionid5
subscriptionid subscriptionid quantity5
n islock y5
autoplay true autoplayspeed5
true autoplayspeed 50005
quantity 1 situation5
islock n islock5
alert responsemessage setunlock5
gethttpbusinesstodaycomtwloadingcheckoutshoppingfunctionnewhtml data-ajaxshoppinghtmlnewhtml else5
responsestatus 1 setunlock5
list datatype json4
function response if4
setunlock else if4
var customertoken customertokenval4
1 setunlock else4
1 situation list4
situation list datatype4
response if responsegopagedetail4
else alert responsemessage4
if responsegopagedetail y4
responsegopagedetail y var4
y var msg4
var msg confirm4
msg confirm responsemessage4
confirm responsemessage if4
responsemessage if msg4
if msg true4
responsemessage setunlock if4
setunlock if typeofpage4
undefined page shopping4
else loadmarketprompttype loadingcartitemhtml4
j var nowindex4
j j var4
var j 04
locationreload else if4
page shopping gethttpbusinesstodaycomtwloadingcheckoutshoppingfunctionnewhtml4
subscriptionid quantity 14
j i 64
data-ajaxshoppinghtmlnewhtml else if4
shopping gethttpbusinesstodaycomtwloadingcheckoutshoppingfunctionnewhtml data-ajaxshoppinghtmlnewhtml4
function response alert4
response alert responsemessage4
var nowindex j4
autoplayspeed 5000 arrows3
5000 arrows true3
url apishoppingaddsubscription type3
islock y var3
apishoppingaddsubscription type post3
pageloadingcssdisplay changemarketitemtypecasesproductidquantitymarketidpage function3
0 islock n3
var quantity quantityval3
ajax url apishoppingaddsubscription3
singleproductpage alert windowlocationhref3
href else alert3
if cases checkout3
windowlocationhref checkout else3
checkout else loadmarketprompttype3
loadmarketprompttype loadingcartitemhtml if3
loadingcartitemhtml if type3
if type b3
if type c3
page singleproductpage alert3
undefined page singleproductpage3
locationhref href else3
else if typeofpage3
islock n function3
customertoken customertokenval ajax3
customertokenval ajax url3
alert windowlocationhref checkout3
msg true locationhref3
true locationhref href3
arrows true dots3
if responsestatus24
alert responsemessage17
else if17
responsestatus 116
islock n13
if type11
error function11
ajax url11
success function11
function response11
type post10
datatype json10
false error9
json async9
windowlocationhref checkout9
async false9
responsestatus 08
typeofresponsestatus undefined8
function consolelog8
post data8
responsemessage getcustomerordertotal8
consolelog success8
getcustomerordertotal if8
1 windowlocationhref8
if typeofresponsestatus8
typeofpage undefined7
y var7
undefined page7
if typeofpage7
undefined if7
if islock6
0 alert6
responsemessage if6
checkout function6
quantity 16
islock y6
gethttpbusinesstodaycomtwloadingcheckoutshoppingfunctionnewhtml data-ajaxshoppinghtmlnewhtml5
data subscriptionid5
subscriptionid subscriptionid5
autoplayspeed 50005
var postdata5
true autoplayspeed5
autoplay true5
data-ajaxshoppinghtmlnewhtml else5
subscriptionid quantity5
1 setunlock5
n islock5
1 situation5
var quantity5
responsemessage setunlock5
customertoken customertokenval4
responsegopagedetail y4
if responsegopagedetail4
response if4
response alert4
list datatype4
situation list4
else alert4
msg confirm4
if msg4
var customertoken4
confirm responsemessage4
var msg4
page shopping4
msg true4
setunlock if4
6 html4
nowindex j4
var nowindex4
j var4
j j4
j 04
var j4
setunlock else4
shopping gethttpbusinesstodaycomtwloadingcheckoutshoppingfunctionnewhtml4
6 var4
checkout else4
else loadmarketprompttype4
loadmarketprompttype loadingcartitemhtml4
if cases4
locationreload else4
href else3
url apishoppingaddsubscription3
5000 arrows3
arrows true3
apishoppingaddsubscription type3
loadingcartitemhtml if3
locationhref href3
0 islock3
timeout null3
2020-10-21 iphone123
n function3
1 var3
idval var3
var marketid3
pageloadingcssdisplay changemarketitemtypecasesproductidquantitymarketidpage3
changemarketitemtypecasesproductidquantitymarketidpage function3
quantity quantityval3
true locationhref3
quantity quantity3
page singleproductpage3
singleproductpage alert3
alert windowlocationhref3
type b3
type c3
cases checkout3
situation single3
customertokenval ajax3
true dots3
var90
if89
function54
else32
030
130
type28
responsestatus24
alert23
responsemessage21
undefined20
islock19
true18
quantity17
j16
subscriptionid16
n14
checkout13
213
response12
false12
y11
setunlock11
error11
url11
windowlocationhref11
success11
ajax11
post10
json10
cases10
datatype10
async9
getcustomerordertotal9
data8
consolelog8
msg8
---8
couponnumber8
typeofresponsestatus8
situation7
page7
typeofpage7
loadingcartitemhtml7
rid6
marketid6
bookid6
gifts6
mobileflag6
idval6
href6
modal5
data-ajaxshoppinghtmlnewhtml5
gethttpbusinesstodaycomtwloadingcheckoutshoppingfunctionnewhtml5
actionurl5
autoplay5
autoplayspeed5
35
postdata5
locationreload4
confirm4
responsegopagedetail4
list4
customertokenval4
customertoken4
nowindex4
html4
productid4
timeout4
44
locationhref4
shopping4
b4
loadmarketprompttype4
pageloadingcssdisplay4
presentid4
changemarketitemtypecasesproductidquantitymarketidpage3
android3
quantityval3
latestnewscount3
slick3
keyword3
arrows3
replacehtml3
latestfinancelastcount3
latestfinancecount3
latestnewslastcount3
timee3
lectureid3
apishoppingaddsubscription3
behavior3
iphone123
v3
singleproductpage3
2020-10-213
single3
c3
modalstyledisplay3
53
parseintnumber3
null3
dots3

Who hosts Businesstoday.com.tw?

Businesstoday.com.tw Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Not Applicable
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Not Applicable

Is "" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
0.0045%

HTTP Header Analysis for Businesstoday.com.tw

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 25 Oct 2020 04:10:37 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 21830
Connection: keep-alive
Server: Apache/2.4.41 (Amazon) PHP/7.2.24
X-Powered-By: PHP/7.2.24
Pragma: public
Cache-Control: max-age=1119794, public
Expires: Sat, 07 Nov 2020 03:13:51 GMT
Last-modified: Fri, 23 Oct 2020 03:13:51 GMT
Content-Encoding: gzip
Access-Control-Allow-Origin: *

Businesstoday.com.tw Domain Nameserver Information

HostIP AddressCountry
ns-334.awsdns-41.com 205.251.193.78
ns-1861.awsdns-40.co.uk 205.251.199.69
ns-1239.awsdns-26.org 205.251.196.215
ns-873.awsdns-45.net 205.251.195.105


Need to find out who hosts Businesstoday.com.tw?


Domain Registration (WhoIs) information for Businesstoday.com.tw

 Domain Name: businesstoday.com.tw
Domain Status: clientTransferProhibited
Registrant:
Business Today
CarolineLee Login to show email
No.96 Sec. 1 Nanking East Rd. Taipei 10454 Taiwan, R.O.C. TW Taipei,104,TW
Taipei, TW
TW

Administrative Contact:
CarolineLee Login to show email
Contact:
CarolineLee Login to show email
expires on 2022-12-30 (YYYY-MM-DD)
Record created on 2004-12-30 (YYYY-MM-DD)

Domain servers in listed order:
ns-873.awsdns-45.net
ns-1239.awsdns-26.org
ns-1861.awsdns-40.co.uk
ns-334.awsdns-41.com

Registration Service Provider: PCHOME
Registration Service URL: http://myname.pchome.com.tw

Websites with Similar Names

Busin.cz
Obec Bušín - Oficiální stránky Obce Bušín
Busin.net
The domain name Busin.net is for sale
Busin3ss.com
BUSIN3SS™ — The 9List™
Busina-dzi.info
Срок регистрации домена busina-dzi.info истёк
Busina-dzi.org
503 Service Temporarily Unavailable
Busina.ru
Бусина — Главная

Recently Updated Websites

Sesamefalafelct.com (2 seconds ago.)Siesta.org (3 seconds ago.)6ixeventsolutions.com (3 seconds ago.)Ourwonderfullife.org (4 seconds ago.)Teehugs.com (4 seconds ago.)Rapidlylearn.net (6 seconds ago.)Barrylopez.com (6 seconds ago.)Facinmune.com (8 seconds ago.)Jewishtodo.com (9 seconds ago.)Nano-waxing.com (9 seconds ago.)Neillhopkins-insurance.com (9 seconds ago.)Bomagt.org (9 seconds ago.)Jannylalunadepapel.com (10 seconds ago.)Justrowwithit.com (10 seconds ago.)Visitokanaganvalley.com (11 seconds ago.)Edocis-services.com (12 seconds ago.)Mobivia.vin (13 seconds ago.)Conendung.com (13 seconds ago.)4darlenejoy.com (13 seconds ago.)Cashcowautoloans.com (14 seconds ago.)Courierbag.com.my (16 seconds ago.)Srp.gob.gt (18 seconds ago.)Teeneroticpics.com (19 seconds ago.)Spokanegolfshow.com (19 seconds ago.)Celtibio.com (20 seconds ago.)88888888.ceo (21 seconds ago.)Chuaygan.net (21 seconds ago.)Caffechiaveberkeley.com (21 seconds ago.)Assetexchangecncused.com (23 seconds ago.)Yegengineering.com (24 seconds ago.)

Recently Searched Keywords

bengaliwords.com (1 second ago.)daughterswap - madi collins and haley spades - spoiled so good (1 second ago.)trafik kazas 1 (2 seconds ago.)beer and hot (3 seconds ago.)altu003eu003cspanu003eu003cspanu003eu003cspanu003eu003cspanu003ecalmareu003cdivu003enu003ctdu003enu003ctru003enu003ctru003enu003ctd stylewidth 261467u003enu003cdiv (3 seconds ago.)baskin robbins cake (6 seconds ago.)edugains math (6 seconds ago.)急速报价 (7 seconds ago.)troll names (9 seconds ago.)minicreditosy (11 seconds ago.)韩剧tv下载电脑版 (12 seconds ago.)news & announcements (13 seconds ago.)effectbounce drop ukramediacom35n (13 seconds ago.)童颜少女 (19 seconds ago.)车间主任 翻译 (19 seconds ago.)�follow us on facebook (21 seconds ago.)découvrir ! (22 seconds ago.)bpm.thestillresort.com (26 seconds ago.)b gi s (28 seconds ago.)superhero names (29 seconds ago.)bình tích điện mặt trời (30 seconds ago.)vvwavfftlkrwpbjiga (31 seconds ago.)员工评价 (32 seconds ago.)authorised payment processor vendo (32 seconds ago.)aspergers syndrome (34 seconds ago.)-  bài thuốc trị sỏi mật, sỏi thận, sỏi tiết niệu (35 seconds ago.)arppricingtablecolumnwrappernoanimationarpstyle2notnotransitionnotmaincaptioncolumnnotarpdisablehovercolumnhighlight (36 seconds ago.)dzemdības ūdenī atsauksmes (36 seconds ago.)turiguia (38 seconds ago.)architectural products (38 seconds ago.)