Ca.gov  |  California Home Page
High trust score  | 
State of California




Ca.gov Website Information

Website Ranks & Scores for Ca.gov

Statvoo Rank Statvoo Rank:A
Alexa Rank Alexa Rank:821
Majestic Rank Majestic Rank:211
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Whois information for ca.gov

Full Whois Lookup for Ca.gov Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Ca.gov. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% DOTGOV WHOIS Server ready
Domain Name: CA.GOV
Status: ACTIVE

>>> Last update of whois database: 2017-08-15T13:36:16Z

Who hosts Ca.gov?

Ca.gov is hosted by California Technology Agency in California, Rancho Cordova, United States, 95741.
Ca.gov has an IP Address of 67.157.98.46 and a hostname of www.ca.gov and runs Microsoft-IIS/8.5 web server.



Ca.gov Web Server Information

Hosted IP Address:67.157.98.46
Hosted Hostname:www.ca.gov
Service Provider:California Technology Agency
Hosted Country:United StatesUS
Location Latitude:38.5891
Location Longitude:-121.3027
Webserver Software:Microsoft-IIS/8.5
Google Map of 50,12

HTTP Header Analysis for Ca.gov

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Length: 54027
Content-Type: text/html
Server: Microsoft-IIS/7.5
X-Powered-By: ASP.NET
Date: Fri, 22 May 2015 13:03:57 GMT


Need to find out who hosts Ca.gov?

Ca.gov Free SEO Report

Website Inpage Analysis for Ca.gov

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Ca.gov

1toppagesnbspoldcookieinfovehiclegetdepartment200 settimeoutfunctiongetfavorites10px margin 10px10px 0pxpositionfirstcollinkslistbusinesslaunch serviceservice see detailscolornbsp0 varblocknonetwitter listservicefavoritetitleinnerhtml mycan i applyaddtitle10px 0px 0pxjobmy pagesnbspapplicationmanagefullboldcursor0px 10px4nbsp nbsplocatecalifornia39sfind a stateaddtitlereplaceanimatetopdroughttaxesmodal functioninsurance claimffflinkcountcursor pointerguideclaimviewdetailslinktitlepairs10pxcounterinformationcourtsclicksunemployment insuranceservices2unemploymentsalesdocumentgetelementbyidspancaptioninnerhtmlfirecolor fff textdecorationtop 0settimeoutfunction favoritetitleinnerhtml myvaluebuttondocumentgetelementbyidabbrcopyinnerhtmlparkcagovnewitemfairstate parkcolor ffffunctionemployment developmentnewlistservice seeshowmypagesaccesscancagovernmentzindexdoopacitycaliforniacalcaliforniasfaqsyouyourwildfiretaxdevelopment department eddtextdecoration nonegovernorrsquosuser clicksstatedefaultfishing licensemore0px 0px 0px4pxeconomylaunch service seedocumentgetelementbyidfavoritesmodalregistereducationmanage yourtextdecorationfff textdecoration noneedd200 settimeoutfunction favoritetitleinnerhtmlapplocalemploymentyour unemploymentbackgroundcolor 32373cstate of californiaopportunitiesaddtitle addtitlereplacealertsofficetwitterrightposition fixedautoupdisabilitymargin 10pxlearnpadding 0px 0pxcalifornia departmentcontentcontractorregistrationvisitorsvarstatusfeedbackfontsizepaddinghealthvar modalmymodaluser0px 0pxaddtitlereplace addtitle addtitlereplacestarttimemargin 10px 0pxstatisticslearn moreoldcitypadding 0px10px marginfff textdecorationlook upentitypagesnbsp nbspifsearchinsurancecookielocationcaptiontextemployment development departmentlawmy pages04spointerusaddtitle addtitlereplace addtitlefavoritetitleinnerhtml my pagesread morefavoritetitleinnerhtmlcontactfixedrenewaddtitle addtitlereplaceampelsedepartment eddreadcheckdisplaylaunchpagescopyapply0px3currentaddtitlereplaceampheightexpiresonlinefind a joblinksee detailsfishingfile for unemploymentshowfavoriteslinkhtmlsettimeoutfunctionaidsettimeoutfunction favoritetitleinnerhtmlagenciesbackgroundcolorbusiness entityfindsee details faqs0100 fullwidthlicensegovernorrsquos officevar modal documentgetelementbyidfavoritesmodalyour unemployment insurancelookdownloadocmarginaddtitlereplace addtitleaddtitlereplaceamp and addtitleparks0px 10px marginunemployment insurance claimmodalstyledisplay nonelocation520pxhasmanage your unemploymentnewvar i 0resourcesmodalstyledisplayfontweight boldfileseemodal documentgetelementbyidfavoritesmodalusenewsmy pagesnbsp nbspshowfavoriteslinkinnerhtmlfavoritetitleinnerhtml my pagesnbspbackgroundstate job32373clist by cagovernmentgovernorpaddingtopdetails faqssecondcollinksnamefontweightcopyrighttextdevelopment6requestdevelopment departmentclose

Longtail Keyword Density for Ca.gov

KeywordsOccurences
0px 0px 0px10
settimeoutfunction favoritetitleinnerhtml my6
find a job6
addtitlereplaceamp and addtitle5
10px margin -10px4
margin -10px 0px4
find a state4
favoritetitleinnerhtml my pages4
my pagesnbsp nbsp4
service see details4
-10px 0px 0px4
0px 10px margin4
launch service see4
file for unemployment4
state of california3
var i 03
employment development department3
addtitle addtitlereplace addtitle3
addtitlereplace addtitle addtitlereplace3
200 settimeoutfunction favoritetitleinnerhtml3
var modal documentgetelementbyidfavoritesmodal3
favoritetitleinnerhtml my pagesnbsp3
fff text-decoration none3
unemployment insurance claim3
padding 0px 0px3
list by cagovernment3
your unemployment insurance3
manage your unemployment3
see details faqs3
color fff text-decoration3
can i apply3
development department edd3
0px 0px19
look up10
learn more8
read more7
color fff7
favoritetitleinnerhtml my7
addtitle addtitlereplace6
0px 10px6
padding 0px6
settimeoutfunction favoritetitleinnerhtml6
addtitle addtitlereplaceamp5
var modal5
text-decoration none4
top 04
100 full4
10px margin4
-10px 0px4
font-weight bold4
margin -10px4
user clicks4
10px 0px4
background-color 32373c4
service see4
my pagesnbsp4
pagesnbsp nbsp4
state job4
california department4
unemployment insurance4
my pages4
see details4
launch service4
fff text-decoration3
modal documentgetelementbyidfavoritesmodal3
200 settimeoutfunction3
addtitlereplace addtitle3
modal function3
modalstyledisplay none3
cursor pointer3
department edd3
state park3
development department3
employment development3
governorrsquos office3
business entity3
fishing license3
0 var3
twitter list3
nbsp nbsp3
details faqs3
insurance claim3
manage your3
your unemployment3
position fixed3
var60
0px36
california34
024
more24
find23
state20
modal16
if16
my16
information14
addtitle14
learn13
background-color13
function13
job13
your12
color12
nbsp12
department11
do11
up10
location10
top10
110
look10
padding10
unemployment9
file9
business9
apply9
none9
search9
animatetop8
10px8
fff8
locate7
read7
else7
settimeoutfunction7
favoritetitleinnerhtml7
service6
copy6
license6
opacity6
app6
see6
margin6
width6
linktitlepairs6
addtitlereplace6
get6
you6
application5
name5
full5
services5
insurance5
guide5
pages5
can5
development5
launch5
use5
tax5
check5
modalstyledisplay5
addtitlereplaceamp5
claim5
z-index5
close5
wildfire5
position5
agencies5
manage5
background4
fire4
details4
linkcount4
twitter4
block4
firstcollinks4
bold4
font-weight4
font-size4
getfavorites4
pagesnbsp4
clicks4
user4
text-decoration4
-10px4
link4
height4
24
20px4
auto4
32373c4
04s4
4px4
secondcollinks4
california39s4
park4
new4
edd4
health4
right4
faqs4
register4
opportunities4
sales4
contact4
us4
renew4
vehicle4
contractor4
registration4
governor4
local4
californias4
oldcookieinfo4
current4
entity3
showmypages3
office3
documentgetelementbyidfavoritesmodal3
showfavoriteslinkhtml3
governorrsquos3
documentgetelementbyidabbrcopyinnerhtml3
cookielocation3
news3
resources3
33
view3
request3
taxes3
drought3
expires3
counter3
43
copyrighttext3
default3
newitem3
captiontext3
documentgetelementbyidspancaptioninnerhtml3
access3
showfavoriteslinkinnerhtml3
53
alerts3
status3
value3
newlist3
button3
online3
fishing3
content3
download3
pointer3
cursor3
fixed3
fair3
padding-top3
cagovernment3
feedback3
cagov3
statistics3
display3
courts3
parks3
cal3
law3
economy3
has3
list3
oldcity3
oc3
63
education3
disability3
aid3
visitors3
starttime3
employment3

What are the nameservers for ca.gov?

Ca.gov Domain Nameserver Information

HostIP AddressCountry
ns5.net.ca.gov 134.186.254.247United States United States
ns6.net.ca.gov 158.96.0.249United States United States
ns7.net.ca.gov 165.235.254.249United States United States

Ca.gov DNS Record Analysis DNS Lookup

HostTypeTTLExtra
ca.govA42676IP: 134.186.61.39
ca.govNS43200Target: ns5.net.ca.gov
ca.govNS43200Target: ns6.net.ca.gov
ca.govNS43200Target: ns7.net.ca.gov
ca.govSOA43200MNAME: ns6.net.ca.gov
RNAME: dnsrequest.state.ca.gov
Serial: 2011630862
Refresh: 10800
Retry: 1080
Expire: 2419200
ca.govMX43200Priority: 50
Target: mail.dtsgc.ca.gov
ca.govTXT43200TXT: kgSwb3w
ca.govTXT43200TXT: v=spf1 mx ~all
ca.govTXT43200TXT: v=msv1
t=F21F2D2B-4B5C-4E0B-BEA8-3D3B29925C55

Alexa Traffic Rank for Ca.gov


Alexa Search Engine Traffic for Ca.gov