Campermarkt.nl - campers - nieuw en gebruikt

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-28
Category: This site has not been categorized yet

De gratis camper marktplaats.


Domain summary

Domain label
campermarkt
Domain extension
nl
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is campermarkt.nl ranked relative to other sites:

Percentage of visits to campermarkt.nl from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Campermarkt.nl registered?
A: Campermarkt.nl was registered 4 months, 1 week, 1 day, 12 hours, 59 minutes, 28 seconds ago on Wednesday, October 28, 2020.
Q: When was the WHOIS for Campermarkt.nl last updated?
A: The WHOIS entry was last updated 4 months, 1 week, 1 day, 12 hours, 59 minutes, 28 seconds ago on Wednesday, October 28, 2020.
Q: What are Campermarkt.nl's nameservers?
A: DNS for Campermarkt.nl is provided by the following nameservers:
  • ns2.inter-it.nl
  • ns3.inter-it.nl
  • ns.inter-it.nl
Q: Who is the registrar for the Campermarkt.nl domain?
A: The domain has been registered at Stichting Internet Domeinregistratie NL.
Q: What is the traffic rank for Campermarkt.nl?
A: Campermarkt.nl has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Campermarkt.nl each day?
A: Campermarkt.nl receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Campermarkt.nl resolve to?
A: Campermarkt.nl resolves to the IPv4 address 85.214.116.61.
Q: In what country are Campermarkt.nl servers located in?
A: Campermarkt.nl has servers located in the Germany.
Q: What webserver software does Campermarkt.nl use?
A: Campermarkt.nl is powered by Nginx webserver.
Q: Who hosts Campermarkt.nl?
A: Campermarkt.nl is hosted by STRATO AG in Land Berlin, Berlin, Germany, 12529.
Q: How much is Campermarkt.nl worth?
A: Campermarkt.nl has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Campermarkt.nl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Campermarkt.nl Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Campermarkt.nl

H1 Headings

1 :
  1. de gratis marktplaats voor nieuwe en gebruikte campers

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

45 :

Google Adsense

:
pub-7822329372350220

Google Analytics

:
UA-29594000-8

Links - Internal

84:

Links - Internal (nofollow)

0:

Links - Outbound

54:

Keyword Cloud for Campermarkt.nl

veeltkoopvandrenthestandmotor5modelnotksoortaangebodenregio gelderlandconditiegelderlandconditiemaxmassagoedfiat ducatonieuwe0prijs notksoort aangebodenregiocmgroteonzeducatonotksoort aangebodenregio7bekledingsunoverijsselconditie gebruiktdatumcampersnatuurlijkwefiatbjmax massaweinsberg4 slaapplaatsennatuurlijk noordendezekoelkastcafransnettebouwjaarluifelapkhijbeddenrijklaarfrans bedbreedteinterieurtotallebedgebruiktdatumopaangebodenregio overijsselconditievwaangebodenregio overijsselconditie gebruiktdatum4omchassiskgslaapplaatsen 4keukenkuntoverijsselconditietevoorzitplaatsenbrandstofdieselkmgewichtlengteeencamperwijaangebodenregiozeerhoogtelediggoogleadclientcapub7822329372350220googleadslot1897095801googleadwidth728googleadheight902xdoucheautomaatufietsenbrandstof diesel1ledig gewichthetonderhoudenheeft2kaneuromercedesmooieaanrijbewijspk8alsnbspnaargoed onderhoudengrootprijs notksoortmeterkenteken6onsmetslaapplaatsen3zijnkm standnoordenprijs

Longtail Keyword Density for Campermarkt.nl

KeywordsOccurences
aangebodenregio overijsselconditie gebruiktdatum4
prijs notksoort aangebodenregio3
fiat ducato6
km stand4
aangebodenregio overijsselconditie4
overijsselconditie gebruiktdatum4
slaapplaatsen 43
4 slaapplaatsen3
goed onderhouden3
aangebodenregio gelderlandconditie3
brandstof diesel3
frans bed3
ledig gewicht3
max massa3
prijs notksoort3
notksoort aangebodenregio3
natuurlijk noorden3
met31
camper24
prijs20
op19
aangebodenregio19
van16
gebruiktdatum16
012
km12
voor12
kg11
een10
slaapplaatsen10
fiat10
19
bouwjaar8
te7
apk7
onze7
ducato7
pk7
27
zeer7
meter6
motor6
mooie6
deze6
u6
hij6
nieuwe6
bedden5
cm5
lengte5
tot5
naar5
gewicht5
35
drenthe5
googleadclientca-pub-7822329372350220googleadslot1897095801googleadwidth728googleadheight905
45
massa5
goed5
koop4
heeft4
ledig4
groot4
stand4
bed4
diesel4
veel4
nbsp4
onderhouden4
overijsselconditie4
natuurlijk4
hoogte4
breedte4
interieur4
ca4
kenteken4
keuken4
kan4
54
het4
douche3
automaat3
noorden3
max3
63
om3
euro3
bekleding3
fietsen3
koelkast3
we3
mercedes3
notksoort3
73
rijklaar3
2x3
brandstof3
grote3
sun3
83
vw3
chassis3
alle3
ons3
zijn3
gelderlandconditie3
zitplaatsen3
campers3
rijbewijs3
nette3
als3
t3
wij3
aan3
bj3
model3
kunt3
frans3
luifel3
weinsberg3

Who hosts Campermarkt.nl?

Campermarkt.nl Hosting Provider Information

Hosted IP Address:85.214.116.61
Hosted Hostname:ds-01.inter-it.nl
Service Provider:STRATO AG
Hosted Country:GermanyDE
Location Latitude:52.5174
Location Longitude:13.3985
Webserver Software:nginx

Is "STRATO AG" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%
STRATO AG
0.8410%

HTTP Header Analysis for Campermarkt.nl

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Wed, 28 Oct 2020 00:32:00 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://campermarkt.nl/

Campermarkt.nl Domain Nameserver Information

HostIP AddressCountry
ns2.inter-it.nl 83.96.153.91Netherlands Netherlands
ns3.inter-it.nl 193.172.246.101Netherlands Netherlands
ns.inter-it.nl 83.96.153.90Netherlands Netherlands


Need to find out who hosts Campermarkt.nl?


Domain Registration (WhoIs) information for Campermarkt.nl

 Domain name: campermarkt.nl
Status: active

Registrar:
Inter-IT B.V.
Zuidergracht 21-06
3763LS SOEST
Netherlands

Abuse Contact:

Creation Date: 2012-11-13

Updated Date: 2018-06-21

DNSSEC: yes

Domain nameservers:
ns.inter-it.nl
ns2.inter-it.nl
ns3.inter-it.nl

Record maintained by: NL Domain Registry

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Registrars.
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(c) The Foundation for Internet Domain Registration in the Netherlands
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).

Websites with Similar Names

Campe-fahrzeugbedarf.de
Campe Fahrzeugbedarf GmbH
Campe.xyz
campe.xyz
Campeach.com
campeach.com -&nbspcampeach Resources and Information.
Campeador-residence.ro
Campeador Residence Romania | Apartamente de vanzare Timisoara si Cluj-Napoca | Apartamente Timisoara si Cluj-Napoca - Home
Campeagle.org
Camp Eagle Homepage

Recently Updated Websites

Umzuege-leipzig-buchen.com (1 second ago.)Winatripwithtresmonjitas.com (1 second ago.)Greencityhemp.com (1 second ago.)Attractionsbooking.com (2 seconds ago.)Clubnbuy.net (2 seconds ago.)Strangeaesthetic.org (2 seconds ago.)Reviewscloud.org (2 seconds ago.)30neutralvalley.com (3 seconds ago.)Zea.capital (3 seconds ago.)Prime-a-la-demat.com (4 seconds ago.)Fundukleev.kiev.ua (4 seconds ago.)Vivianmarti.com (4 seconds ago.)Hm-berlin.org (4 seconds ago.)C41l-today.com (5 seconds ago.)Uedaalfa.com (5 seconds ago.)Rzzss.com (5 seconds ago.)Cinetorrent.net (6 seconds ago.)Wickedgoodplan.com (6 seconds ago.)Pdkid.com (6 seconds ago.)Yanvalas.online (7 seconds ago.)Staydryroofingoftampabay.com (7 seconds ago.)Imoel.com (7 seconds ago.)Moonviews.com (7 seconds ago.)Dig-elite.com (8 seconds ago.)Dominekenit.com (8 seconds ago.)Beginwithquality.com (8 seconds ago.)Basag.link (8 seconds ago.)Kou-sushi.com (8 seconds ago.)Fascitisplantar.org (8 seconds ago.)Give-kindness.org (9 seconds ago.)

Recently Searched Keywords

advertising jasa seo (1 second ago.)lue lisää » (4 seconds ago.)commercial items (5 seconds ago.)s1s2s3s4s5s6s7s8s9s10s11s12s13s14s15s16s17s18s19s20s21s22s23s24s25s26s27s28s29s30s31s32s33s34s35s36s37s38s39s40s41s42s43s44s45s46s47s48s49s50s51s52s53s54s55s56s57s58s59s60s61s62s63s64s65s66 (8 seconds ago.)پژوهش (10 seconds ago.)tatkal meaning (11 seconds ago.)olives 橄欖 (11 seconds ago.)reforma integralview (13 seconds ago.)ebird hotspots (14 seconds ago.)erkek üniforma (15 seconds ago.)letting (16 seconds ago.)создать новый (18 seconds ago.)web gradients (19 seconds ago.)green herb (21 seconds ago.)ggf (23 seconds ago.)gift tv show (25 seconds ago.)veritable meaning (26 seconds ago.)posso (28 seconds ago.)nos projets (30 seconds ago.)healing roots swift current (31 seconds ago.)integrity in tagalog (33 seconds ago.)vapesoul (34 seconds ago.)12 minutes (35 seconds ago.)bitumen (39 seconds ago.)dados (40 seconds ago.)escort eskort (41 seconds ago.)route optimization (42 seconds ago.)ar terleme (45 seconds ago.)パスタ 簡単 (47 seconds ago.)ember35102385before padding-top 100 (47 seconds ago.)