Canal Sur | RTVA Radio y Televisión de Andalucía

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 39,539
Estimated Worth: $384,480

Canalsur Radio y Televisión desde Andalucía. Emisión en directo y a la Carta.



Domain summary

Last updated
2021-09-30
Domain label
canalsur
Domain extension
es
Global Traffic Rank
39,539
Statvoo Rating
D
Trust Score
Low Trust Score
Estimated worth
$384,480
Estimated daily income
$534
Estimated monthly income
$16,243

Frequently Asked Questions (FAQ)

Q: When was Canalsur.es registered?
A: Canalsur.es was registered 2 months, 1 day, 22 hours, 30 minutes, 24 seconds ago on Thursday, September 30, 2021.
Q: When was the WHOIS for Canalsur.es last updated?
A: The WHOIS entry was last updated 2 months, 1 day, 22 hours, 30 minutes, 24 seconds ago on Thursday, September 30, 2021.
Q: Who is the registrar for the Canalsur.es domain?
A: The domain has been registered at .
Q: What is the traffic rank for Canalsur.es?
A: Canalsur.es ranks 39,539 globally on Alexa. Canalsur.es has a Low Trust Score, and a Statvoo Rank of D.
Q: How many people visit Canalsur.es each day?
A: Canalsur.es receives approximately 44,513 visitors and 267,078 page impressions per day.
Q: What IP address does Canalsur.es resolve to?
A: Canalsur.es resolves to the IPv4 address .
Q: In what country are Canalsur.es servers located in?
A: Canalsur.es has servers located in the .
Q: What webserver software does Canalsur.es use?
A: Canalsur.es is powered by webserver.
Q: Who hosts Canalsur.es?
A: Canalsur.es is hosted by Unknown in .
Q: How much is Canalsur.es worth?
A: Canalsur.es has an estimated worth of $384,480. An average daily income of approximately $534, which is roughly $16,243 per month.

Canalsur.es Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Canalsur.es Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Canalsur.es

H1 Headings

0 :

H2 Headings

44 :
  1. Cádiz y Jaén, en nivel cero, junto a las capitales de Córdoba y Granada y seis distritos
  2. Moreno: Andalucía será "la primera" en recuperar la presencialidad total en los centros de salud
  3. La incidencia en Andalucía baja a los 50,1 casos
  4. UPACE-San Fernando pide ayuda tras varios robos en su aula infantil
  5. Aznar respalda a Casado para "poner la casa en orden": "Ni plurinacional, ni multinivel ni la madre que los parió"
  6. Espadas ve posible un acuerdo presupuestario porque vivimos "un momento excepcional"
  7. Cancelados seis trenes AVE en Andalucía en la primera jornada de huelga en Renfe
  8. Incertidumbre en la pesca y la agroindustria andaluzas por la anulación del acuerdo con Marruecos
  9. Cuando en Lepe llueve, Campanillas tiembla
  10. Lugros, paraíso del empleo
  11. Conducir con el móvil en la mano costará seis puntos con la nueva ley de tráfico
  12. Málaga es la tercera provincia de España con más tramos de riesgo especial para motoristas
  13. Terremoto energético por el conflicto entre Argelia y Marruecos
  14. Buscan a un hombre que robó un coche con un menor dentro en Villanueva del Ariscal
  15. El TSJA confirma la condena al 061 tras la muerte de un paciente por retraso de la ambulancia
  16. Premio a terapias caninas para colectivos vulnerables
  17. La vuelta al mundo de la Nao Victoria en clave infantil
  18. La alternativa de Manuela Carrasco a su hija, broche de la Bienal de Málaga
  19. Rodeado de delfines y leones marinos en Benalmádena costa
  20. Lanjarón, un lugar para relajarse en su balneario y hacer acuatrekking
  21. "Coaching" con caballos en San Fernando, una experiencia inolvidable
  22. Viajamos en el tiempo para conocer la Sevilla del siglo XII
  23. Antonio, un motero con muchos kilómetros recorridos a los 78 años
  24. Los Gipsy Kings llegan a Sevilla tras 15 años sin actuar en Andalucía
  25. La forma más sencilla de preparar una exótica salsa de mango
  26. El cultivo inteligente de fresas ya está aquí con la agricultura "indoor"
  27. Nuevas historias de andaluces en Tanzania
  28. Así se prepara Lea Vicens antes de una corrida
  29. Entrevista a Toni Valero, en "Despierta Andalucía"
  30. Galletas de nata y bizcocho de avena, dos ricos dulces en "Cómetelo"
  31. "La lista de Porfirio", la historia del Schindler de Málaga
  32. Vuelve a escuchar el especial de "La Mañana de Andalucía" desde Úbeda
  33. Manuel Fernández advierte en Canal Sur Radio de la peligrosa dependencia del caladero marroquí
  34. "El Mirador de Andalucía" analiza con los hosteleros la progresiva vuelta a la normalidad
  35. Las ayudas a empresas y autónomos por valor de 1.109 millones, más accesibles
  36. Sigue la racha ganadora del Betis en Europa
  37. El sevillano Gavi, sorpresa en la convocatoria de Luis Enrique
  38. El Sevilla salva un punto de penalti casi al final en el campo del Wolfsburgo
  39. Figuras de nivel mundial participan en la Copa de Naciones de Montenmedio
  40. Blanca Betanzos, imagen de la campaña para reivindicar la participación de atletas Down en París 2024
  41. Información, divulgación y entretenimiento claves de la programación de otoño de Canal Sur Radio y Televisión
  42. El director general de Canal Sur Juande Mellado apoya el estreno de "La Hija" en el Festival de Cine de San Sebastián
  43. "Andalucía Directo" convoca sus IV Premios de Reporterismo
  44. Esperanza Soria hechiza al jurado con unas bulerías de Utrera

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

10 :
  1. Grupo RTVA
  2. Área de negocio
  3. Portal de transparencia
  4. Defensor de la audiencia
  5. Direcciones territoriales
  6. RSC - Compromiso con Andalucía
  7. Perfil del contratante
  8. Canal Sur Produce
  9. Servicios de Booking y Venta de imágenes
  10. Comunicación RTVA

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

228 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

329:

Links - Internal (nofollow)

0:

Links - Outbound

34:

Links - Outbound (nofollow)

0:

Keyword Cloud for Canalsur.es

0px margintopacabecerasecciontvvisited colorappbloquemarcoestructura8p classappcontenidonoticia rowapptextonoticiafontweight 600 coloridactivos cajamenuseccion widthimportant galeria1703459y ahoraminislideshow minifondoslideshowinfoestilo16863510px solid 313131backgroundposition96 98 backgroundrepeatsolid 009539 paddingsemifinalfff paddingleft 10pxtop 290pxaaseccionactive colormenuseccioncabalacartagaleriapaddingtop 5px estilo1492221jcidernavrighttextdecorationcolorgaleria1686178slidermini backgroundcolortransparentimportant height200px marginleftfernando120pxnone colorkeywidth 200pxf1f3f4 bordertop 2pxrscwidth 120pximportantmargintop 0pxfontsize 12px asecciontvflex justifycontentflexend alignitemspadding 0px30px colorcontenedorcab width 100portal de transparencia10px menuseccionfinalblancotv borderrightbtnactivefocusgaleria1686178slider paddingleftgrismargeneswidth 45 displayw 768cabeceraseccioncolor 000 padding178px important15px height 200pxgris color f1f3f426negro10px paddingtop 10pxunderline el usuariotexttransform none colorurlresourcesarchivosoffline20194101554892010218canalsurconlaculturasvgminini24px colorpodcasts galeria1686179slidermedia screen responsivefontweight 700marginleft automargintop 00px galeriajustifycontentflexend alignitems flexenddivdescripciontextoelshowdebertingaleria1703544 minislideshowmargintop 00px galeria1686179display blocknorepeat backgroundcolor transparentheight 80px importanttarde aqumiradorvisitados acabeceraseccionvisitedgrid margintopcolore63027 marginright 2pxcolor000 galeria carnavalesta sobreunderline enlacestodos los175px important galeria1686178sans fontweight15px height 195pxcorreo andaluca directogaleria carnavalappmarcotam5 h2appbloquemarcoestructura8pimportant lineheightbackgroundimage urlresourcesarchivosoffline20194101554892010218canalsurconlaculturasvgdcdcdc solid 1pxtelevisinbackgroundcolortransparentimportant galeria1686179sliderminiresponsive media screencarnaval 2020 semifinalbackgroundposition96aaseccionvisited color 009539block left100 fontsize 50pxbackgroundcolor 000 paddingtopwidth 100 displaytexttransform uppercase aaseccionlinkgaleria1550544linkurlresourcesarchivosoffline20187251532521440369recurso8svg 1px 5pxwidth 175pxdocumenturlpubli24px paddingtop 5pxsansserif fontweight 600100 backgroundrepeatbackgroundcolor f1f3f4 borderbottom768px contenedorcabtv0px widthurlresourcesarchivosoffline20194101554892010218canalsurconlaculturasvg backgroundposition96paddingtop 10px borderradiussolid fff paddingleftdocumentales andalucaestilo1492221 appcintillonoticia fontfamily00953965 displayinlineflex margintop 0pxpara200pximportantcolor 009539 estilo1492221backgroundcolortransparentmas viralnorepeat important fontweightgaleria1562378blackgaleria1554917 minislideshowcolorsuperior efiestapaddingright 10px menuseccionmediobackgroundcolorgaleria1703459 minislideshowtop 118px leftgaleria 1686178 radiofontsize 16pxcolor 000 lineheightpaddingleft 15px paddingrightf1f3f4 estilo1686351 paddingtopimportant galeria1639938appantetitulonoticia10px cajacabecerasecciongaleria1540801 minislideshowcabalacartafinalwidth 100 cajamenusecciontvmindevicewidthgaleria1540803 minislideshowmargintop 0px marginbottomaasecciontvactive colory estilosaaseccionlink color 009539galeria1686180 minislideshow backgroundcolortransparentimportant12px aseccion0px marginbottom 5pxno visitados acabecerasecciontvvisitedappmarcotam20px cabecerasecciontv5px 5px 7pxsans sansserif fontweightgris color0 7px estilo1686351cajamenusecciontv width 65fontsize18px color313131 marginrightsliderminifondo paddingleft30crdobaclose twitter facebookcardheaderfondo blancorsc compromisoleft 15px margintop0 0 2px220px important galeria1703459backgroundcolortransparentimportant heightfffimportant lineheight 24pxgaleria1686179 sliderminifondosobre eleurocopa5px acabeceraseccionlinkcolor fff textdecorationvisitados aasecciontvhover colorpaddingtop 15pxfontsize 30px colormenuseccionmedioblancotvcajaredesincollapsehideuna700 fontsize 14px000 galeriaestilos cajacolor313131solid d8d8d8windowinnerwidth 0 ifgaleria1686179slidermini backgroundcolortransparentimportantnone estilo1515942777 textdecoration400 fontsize 24pxandalucabordertop 2px solidbackgroundcolor000important heightheight 300pxandaluca directogaleria1493226cabecerasecciontv fontfamily opengaleria1686180slider paddingleftmarginright 0px300px importantmargenes y estilosflexend cabecerasecciontv fontfamily2020 fondo informativos7px paddingbottom 10pxbackgroundcolortransparent height 170pxgaleria154079810pxacabecerasecciontvactive color 009539uppercase menuseccion fontweightcarta colorcolor 000importanttierra70px marginleft0px paddingright 10pxsuperior e inferiorcabeceraseccion fontweightcolor 00014px colortextalign rightwhatsapp correo documentcolor fff cajatxtandaluciadecercaprovincialescarta galeria1686178slider paddingleftbackgroundimage urlresourcesarchivosoffline20194101554909043374papeleta2svgfondo gris colorvisitados aaseccionvisited7999 textdecoration underline45pxenlaces nofffimportant lineheightimportant galeria1686178 sliderminifondopaddingtop 5pxtextalign leftgaleria1540801divcontainerespecialtvelshowdebertin margintop autodinamicocajamenusecciontv width 100galeria1381003 minislideshowtransparent color 009539appentradilla fontfamilyacabecerasecciontvlink color fffpie verdemenuseccionfinal borderrightseptiembre 2019 fondocolor009539paddingtop 6pxprogramacinminifondoslideshowinfo width 120pxesgaleria1418359important backgroundcolortransparentimportant color000009539 estilo149222121px paddingbottom 5pxdisplay none estilo1515942important galeria15000524solid 1px galeria1686180eleccioneslineheight 32px12px aseccion texttransform2px solid 000minifondoslideshowinfo width 300pxtodael tiemporowapptextonoticia h2000important18px padding 5pxmenuseccionfinal borderright 0pxcolor fffimportant lineheightescuchar en directo313131 paddingleft 10pxfontsize 12px asecciondisplay block left000000media onlyimportant galeria1500046lineheight 30px paddinginlineflex justifycontentpadding 5px100 fontsize 30pxcorreo a todaactivos cajamenusecciontv widthtextdecoration nonedivplayerprogramaelshowdebertinborderrighthorascover marginleftmenuseccioninicio borderrightmillonesfondo negrorelacionadajan45 cabeceraseccioncolor000 galeriaaseccion fontfamilyclickfunctionpaddingtop 15px paddingbottombottom backgroundrepeatright texttransformaaseccionhoverbackgroundposition90important height 40px45 cabeceraseccion fontfamilyestilo1686351 appbloquemarcoestructura8pflexend cabecerasecciontv025remnowfontweight 400paddingtop 20pxcajamenusecciontv250px important heightminifondoslideshowinfofontsize 50px acabecerasecciontvlink2018 en imagenestextalignmargintop autof1f3f4 marginleft 1pxborderbottomfontweight 100 fontsizeheight 250px importantunderline textdecorationcolor 009539rtvagaleria1562378 minislideshowelecciones 26mactivos menuseccioniniciogaleria informativosimportant fontweightvuelta15px height 230pxescuchargaleria1639938 jcidernavcajacabeceraseccion width 100norepeat backgroundposition rightestilo1515942cajacabeceraseccion widthgaleria1540798 minislideshowimg width 240px14px lineheightmarginrightfilete 1 pxminifondoslideshowinfo backgroundcolortransparent768px contenedorcabtitularnone borderbottomsolidoffsetf1f3f4 fileteusuario esta sobre260px importantappmarcotam4 h218120pximportant border15px height 220pxverdegaleria 1686179 podcastsbackground urlresourcesarchivosoffline20187251532521440369recurso8svgminislideshow backgroundcolortransparentimportant galeria1686179slidermini400 lineheightmaxwidthmarginright 2pxmarginbottom 0pxmenusecciontv fontweight1 pxborderbottom 5pxresponsivelivalcodigopaddingtop 10px backgroundcolormenuseccionmedio borderrightdisplay flex alignitemsgaleria1527524 minislideshowgaleria 1686179fondo grismrgenesmarginright 2px fontsizeestilo1686351 paddingtopmargintop 20pxfff textdecorationimg width 200pximportantuppercase menusecciontv fontweightmenuseccionfinalblancotvcabeceras seccionesimportant backgroundcolortransparent color000backgroundcolor f1f3f4flexend menuseccioninicio borderrightinicioimportant galeria1381003 minislideshowdivplayerprogramaelshowdebertin width2019 elecciones240px important height15px height 260pxcercaheight 260px important2020 fondo grisfontsize 24pxwidth 240px importantelcabpodcasts20px fontweightbackgroundcolortransparent color000clickfunctioneventdeportesvisitadoscajacabalacarta2510px margenescomunicacion18 1012px asecciontvbottom backgroundrepeat norepeat21dcdcdc240px1px 5px norepeatuppercase paddingleft 0pxborderbottom 0pxbackgroundcolortransparentimportant height 178pxf1f3f4768px contenedorcab widthdireccininherit220 fondo blancotextodestacadoinformativosmarginbottom 5px margintop15px margintop 00pxheight40px10px backgroundcolor f1f3f4elecciones generalesmenuseccionfinalblancotv borderrightnivelheight 175pxelecciones generales 28a1px galeria1686180fontweight 700 color175px important galeria1686180important galeria1686178 minislideshowaaseccionlinkenlaces visitados aaseccionhovermargintop 5px widthdcdcdc textdecorationminislideshow backgroundcolortransparentimportantgaleria1639935 jcidernavestilo14922210px color fffimportantestilo1301773galeria1540799700 color fffimportantportelevisin radiogeneralaosimg width 220pxappbloquemarconivel2 appmarcotam2 h2left 0pxno visitados acabeceraseccionvisitedsolid 1pxasecciontv texttransformscreen responsive mediaacabecerasecciontvactive20px fontweight 700cabeceraseccion fontfamily230px importantsolid 1px galeria168617816jcidernav jcidernavleft displayfondo f1f3f4margintop 0px cajacabeceraseccioninherit margintop 5pxsansserif fontsize 20px15px estilo1686351backgroundcolortransparent color000 galeria26px15correo documentappmarcotam8 h2aasecciontvlink color40px important backgroundcolortransparentimportantgaleria1540329 minislideshow175px important galeria1686179220px importantshow de bertngaleria1639938 minislideshowcaja estilo20px padding 5px65 display flexenlaceno visitados aaseccionvisited200px important heightviral32px paddingtop 5pxpaddingbottom 15pxappcintillonoticiaandaluciagaleria1500046 minislideshowbackgroundposition90 100galeria1686180 jcidernav jcidernavleftbackgroundposition96 10020px paddingacabecerasecciontvhover color 009539divdescripciontextoelshowdebertin fontsizeborder1pxrounded color fffcanalgaleria1514036galeria1550547rounded colordivdescripciontextoelshowdebertin fontsize 20pxactivos menuseccioninicioblancotv210pxright texttransform uppercasealignitems flexend paddingbottomgaleria1538189 minislideshowel enlace aasecciontvactive0pximportant2020 fondo blancopaddingleft 0px paddingrighttexttransform none borderbottomauto top 118pxmarginright 1px backgroundcolorpadding 0px 0pxf1f3f4 estilo1686351aaseccionlink colorjcidernav jcidernavrightgrid margintop 0px5px marginbottom0px width autonoticiamenuseccionfinaltop50cfiesta80px importantborderbottom 2pxleft2px solidauto marginbottom 20pxw mathmaxdocumentdocumentelementclientwidth windowinnerwidthsolid 52905aflex000 lineheightfffgaleria1686178 sliderminifondo paddingleftacabeceraseccionvisited color 009539uppercase aaseccionlink10px backgroundcolorgaleria1550544 minislideshowlineheight 16px textalign98 backgroundrepeatvisitados acabeceraseccionvisited colormrgenes 2018minislideshow img widthauto marginbottomauto heightsansserif fontweight300 fontsizeunderline elaasecciontvactive color 009539marginright 1px paddingtop7pxvar schedule tagmenuseccioninicioblancotv i fontsize18pximportant galeria1686180lineheight 24px paddingtopestilo1492221 appbloquemarconivel2solid 009539important margenesimportant galeria1703544todos los programasgaleria1301919entrevistaheight 230px0px solid fffcolor fffimportant178pxacabeceraseccionhover colorflex aligncontent260pxfontfamily openfondo informativos220 fondounderline700 fontsizefontsize 14pxalignitems inherit margintopcajaredescajacabecerasecciontv width 100positionimportant fontweight 600h2 a appmarcotam4fontweight 400 lineheightgaleria1550543 minislideshowf1f3f4 pie24270px important10fontweight 700 fontsizepaddingbottom 0px cabecerasecciontvtransparent fontfamily15px height 300px2018 fondo15px height 175pxgaleria1686179 sliderminifondo paddingleftsliderminifondono visitadoshecho170px important galeria163993830pxcolor fffimportant estilo1686351galeria1500052width auto height170px importanth2 a appmarcotam8aseccion fontfamily openseptiembre220px important height50pxcolorfff marginright 2pxheight 178px importantpaddingright 10px menuseccionmedioblancotvalmera000 solidulenlace acabeceraseccionactive colorgaleria1554917heightinlineflex margintop 20pxborderright 0px1686179 podcastspaddingtop 10px paddingbottomgranadaheight 0pxpaddingbottom 0px borderbottomrecuadro filetecajamenusecciontv width313131 paddingatitulonoticiatiempo600 fontsizehfontfamilymarginbottom 0px paddingtopimg width 300pxappcontenidodestacadoinformativos textodestacadoinformativos titulodestacadoinformativosblancoimportant galeria1686180 sliderminifondocontaingaleria1686179sliderbackgroundcolor 000canal andalucaheight 220px15px paddingbottom 30pxcolor 000 paddingtopdivdescripcionprogramaelshowdebertin widthflex justifycontentflexendtexttransform initial borderbottomcontenedormenumovil10px paddingbottom 15pxbackgroundcolortransparentimportant height 170pxcolor 000 textdecorationheight 230px importantdivtituloprogramaelshowdebertin width009539 textdecorationappmarcotam3 h2cabecerassaludfff estilo1301773fondo blanco filetegaleria1686178slidermini backgroundcolortransparentimportant0px marginbottom 0px22block left 15pxaaseccionactive color 999acabecerasecciontvhover600 paddingrightenlace aasecciontvactivecolorffffff lineheightmarginjcidernav jcidernavleftproducef1f3f4 marginleftfff estilo1492221marginbottom 0px color290px100px30px texttransform uppercasebackgroundrepeat norepeat backgroundcolordivcontainerespecialtvelshowdebertin margintopacabecerasecciontvhover colorcolor 000 galeriamarginright 1px marginbottomgaleria eleccionesgaleria1686180 minislideshowfff paddingleft 0pxsobre el enlace30px borderbottom 2pxcompartir close twittercajamenuseccion margintopinferior azulcarta noticias provincialesflexstart alignitems inherit30px borderbottomwidth 100 cajamenuseccion00px galeria1686180aligncontent flexstartsur205px importantmedia screenfondo 2018border dcdcdcgris f1f3f4backgroundcolortransparentimportant galeria1686180sliderminiestilo 2020f1f3f4 borderbottomtransparencia1px color fff5px width 100fontfamily open sansmenuseccioncaja estilo 2020galeria1686179slidermini backgroundcolortransparentimportant heightflamenco galeria1686180slider paddinglefttransparent fontfamily open30px texttransformurlresourcesarchivosoffline20194101554909043374papeleta2svg10px margenes cajaaasecciontvlinke313131 padding 0px1px paddingtop 10pxmaxwidth 768px contenedorcabmarginbottomculturamarruecosul libackgroundrepeat norepeat backgroundsizeestilo1301773 marginleftgaleria1686179caja estilo 220600 colorprimeroimg width 120pximportantborderradiusazulimportant height 80pxfondo blanco pieenlace acabecerasecciontvactiveheight 200pxwidget0 if wh2 a appmarcotam3backgroundimage urlresourcesarchivosoffline20194101554892010218canalsurconlaculturasvg backgroundposition96responsive mediaheight 195px important400 color fffborderradius 0width 120px importantpescaasecciontvclickfunctionevent var wuppercase aasecciontvlink colornorepeat backgroundpositionmenuseccionfinalblancotv i fontsize18pxforvarfontsize 30px texttransformappmarcotam2 h2 fontfamilybackgroundrepeat norepeatmenuseccionmedioblancotv borderrightsur producewidth 300pxfff widthbordertopeventstoppropagationdisplay flex aligncontentshowf1f3f4 borderbottom 2pxgaleria1415541 minislideshowgaleria elecciones 26mgridfontsize 21px paddingbottom2pxenlace aaseccionactivepodcasts estilo16863512px solid 009539importantbackgroundcolor blacknone enlaces noopen0px important backgroundcolortransparentgaleria1686179 minislideshow minifondoslideshowinfoclickfunction cajaredesincollapsehidealigncontent flexstart alignitems1px marginbottomacabecerasecciontvvisited color ffftransparenthtml10px menuseccionmediogaleria1540800hatop 118pxunminislideshow backgroundcolortransparentimportant galeria1686180sliderminicolor 313131color 777 textdecorationflex alignitems flexendmedia only screentextdecorationcolor 009539100 cajamenusecciontv widthinitial borderbottomenlace aasecciontvactive colorgaleria1415541menuseccionmedioblancotv borderright 1pxtarde aqu yseismsestilo1686351 appmarcotam4maxwidth 768px contenedorcabtvbackgroundposition bottominlineflex justifycontent flexstartpaddingtop 10pxgenerales 28a fondomlaga009539 padding 02000012270pxgaleria1653897mathmaxdocumentdocumentelementclientwidth windowinnerwidthurlresourcesarchivosoffline20194101554917231136eleccionesgeneraleslogo28asvgwidth 120px100 display grid000 solid 1pxgaleria 1686180appcintillonoticia fontfamily open12px1686180 flamenco galeria1686180sliderbackgroundcolortransparentimportant galeria1686180slidermini backgroundcolortransparentimportantmarginbottom 10px cajacabeceraseccionsliderminifondo paddingleft 15pxnorepeat backgroundcolorvisitados acabecerasecciontvvisited colorseptiembre noticiastransparent marginleft 1pxmenuseccioniniciotop50cfiestatitulodestacadoinformativostwitter6pxwidth 205px important00753b220px important galeria1639935galeria1653933 minislideshowminifondoslideshowinfo width 250pxpaddingleft 15px0px marginrightforvar i 1caja estilo 201810px borderradius 5pxacabeceraseccionhovertodoscabecerasecciontv fontfamily1px galeria1686180 minislideshow1px 5pxh2 a appmarcotam6correo andalucalo mas viralcenterel usuario esta2galeria1686180 sliderminifondourlresourcesarchivosoffline20194101554892010218canalsurconlaculturasvg backgroundposition96 98height 220px important14no visitados aasecciontvvisitedcerca link2px 1pxsansserif fontsize 26pxsur conel enlace aaseccionactive118pxgaleria14181715px texttransform uppercasefacebook whatsapp correo0px cajacabeceraseccionhuelvamenuseccioninicio i fontsize18pxlineheight 18pxborderbottom 2px solidappmarcotam6compartir closesemana santartva comunicacinscreen and maxwidthflexend menuseccioninicioeste viernesgaleria1686178 jcidernav jcidernavrightestilo1686351 appmarcotam4 h25px width auto5px norepeat importantsans sansserif fontweight300estilo 220 fondosansserif fontweight 400120pximportantf1f3f4 pie inferiorheight 40pxtras10px paddingrightmundocabeceraseccion fontweight 100h2 a fontsize14px lineheight 16pxbarraprovincias ul ligaleria1550546appmarcotam4height 0px importantdivtituloprogramaelshowdebertinportada radioif wscreenborderright 0px solid1686179 podcasts galeria1686179sliderwidth 200px importantborderbottom 1pxcolor777tituloprogramaflexend paddingbottom 10px175px importantwidth 220px1px marginbottom 20pxtextdecoration underline textdecorationcolorleft 15pxappcontenidodestacadoinformativos textodestacadoinformativoslineheight 19px important16px colorbackgroundrepeat norepeat backgroundposition0px 0pxacabeceraseccionvisited colorfontsize 30px paddingbottombackgroundcolortransparentimportant galeria1686178slidermini backgroundcolortransparentimportantfunctionjustifycontent flexstartsinsolid 0095393f8bcd borderbottom 2pxgaleria1500046009539importantclassappcontenidonoticia rowapptextonoticiaappantetitulonoticia fontfamilytitulovideoultimobackgroundimage urlresourcesarchivosoffline20212281614532411695tramatriangulos2000x3000jpg50px acabecerasecciontvlinktardebackgroundposition96 100 backgroundrepeatwindowinnerwidth 0contenedorcabalacartaestilo1686351 backgroundimage urlresourcesarchivosoffline20212281614532411695tramatriangulos2000x3000jpgmarginbottom 10px backgroundcolorvisitados acabecerasecciontvhover colorcolor000 galeria eleccionesmarginbottom 20pxcolor f1f3f4maxdevicewidthe63027009539important margenes170px important galeria17035442019 elecciones generalesgeneralesfff cajatxtandaluciadecercaprovincialesdisplay noneestilo 22020px marginbottomgaleria1514036 minislideshowsolid e6302720px paddingtop 15px3pxfontsize18px colorfff marginright15px height 210pxborderradius 5px backgroundcolorpaddingright 0pxjcidernavleftvisitados acabecerasecciontvhover10px menuseccionmedio borderrightpxaquappbloquemarconivel210px menuseccionmedioblancotv borderright00px fondos1px solidpiecomunicacion10px menuseccionfinalblancotvcajaredes clickfunctioneventgaleria1686180slidermini backgroundcolortransparentimportant18px paddingactivos cajamenuseccionh2 a appmarcotam5cineno diarios15pxsemana6px paddingleftcon50px paddingbottom 5pxacuerdobackgroundsizepadding 5px 5pxpaddingtoppaddingright 10px asecciontv300pxbackgroundcolor f1f3f4 bordertopalignitems inheritvarsolid 3f8bcd200px important galeria1686180texttransform uppercase paddingleft3f8bcdinferiorsobrelineheight 16px009539important margenes cajabackgroundpositionfontsize 21pxaasecciontvhover color 009539texttransform initialel enlace acabeceraseccionactiveappmarcotam3backgroundcolor f1f3f4 marginleftappmarcotam8classappcontenidonoticiatoda costa30px color 313131240px importantfondo informativos nogaleria1686180sliderminifontsize 26px fontweight6menuseccionfinalblancotv borderright 0pxcolor fffcovercompartir4pxbackgroundcolor transparent100 display inlineflexy1px paddingtopgaleria1639938paddingbottom 30pxright 0pxvar wcajamenuseccion width 65roundedwindowinnerwidthcolor fff estilo1301773marginbottom 10pxestilo1686351 titulodestacadoinformativoscanal fiestabackgroundcolor transparent backgroundsizefontsize 20px fontweightappbloquemarconivel2 appmarcotam1250px1px galeria16861785pxaasecciontvhover colorvisitados aasecciontvhover32px paddingtop170pxpaddingright 10px menuseccionfinalestilo1493085acabecerasecciontvvisitedtexttransform uppercase aasecciontvlinkhttpswww3smartadservercomacsiteid396542fmtid98591ab1tgtoc1outvast4ps1pb3visitsvcnsvphplayerheightvpwplayerwidthvpmt1tmstptimestampgdpr1gdprconsentgdprconsentpgid777 textdecoration underlineimportant backgroundcolortransparent color777sans sansserifgenerales 28afondo gris 28asolid fff120pximportant border dcdcdc16px textaligncajafontsize 16px colorgaleria1686179 jcidernav jcidernavleft0px borderbottom 2px5px norepeatusuariosolid 313131 paddingleft10px paddingright 0pxcontenedorcabtv widthpaddingbottom 10px menuseccioninicioblancotve inferior azulmargenes ygaleria1527524fontsize18pxmargintop 5px10px menuseccioninicioblancotv12px menuseccionfinalblancotvfontsize18px colore63027lineheight 24pxurlresourcesarchivosoffline20187251532521440369recurso8svg 1pxfondogaleria1639935desdefontsize18px colorfff100 backgroundrepeat norepeat000 paddingtopminislideshow minifondoslideshowinfo width16px textalign rightdestacadoborder009539 margenes yiniciogethours minini28a fondo blancomargintop 00px galeria1686180maxwidth 768px mrgenes2px solid 52905adirecto en directopaddingleft 0pxbackgroundimagemenusecciontv fontweight 600informativos nojcidernavleft display block0 ifmarginleft auto widthgaleria1686179slider paddingleftcajacabecerasecciontv widthmediarecuadroenlaces activos menuseccioninicioblancotv220pxonlyheight 50pxcompromiso conprogramasrsc compromiso conaqu y ahoragaleria1540800 minislideshowinlineflexgaleria1540803divdescripcionprogramaelshowdebertinpie inferior verdedocumentalesminislideshow backgroundcolortransparent0pxblock rightdocument clickfunction cajaredesincollapsehide0px colorgaleria 1686178fff paddingleftvar scheduleproduce canal surcolor 009539importantfontsize 14px coloruppercase menusecciontvgaleria1686180slidercolor 313131 paddingdisplay block righttwitter facebook whatsappauto topcarnavalcolor 009539border dcdcdc solidgaleria155054325pxcolore63027400 fontsize 14pxwidth 240pxbackgroundcolor transparent marginleftalignitems1px marginbottom 0pxborderbottom 5px solid15px paddingrightalignitems flexend cabecerasecciontvfilete5px texttransformestilo1301773 marginleft 1px19px importantlo2px 1px colorwidth 65paddingbottom 5px texttransformborder 000minifondoslideshowinfo width 240px00px galeria1686180 jcidernavminislideshowdatagaleria1686178 minislideshow minifondoslideshowinfoalignitems flexend13important galeria1446265inherit margintopminislideshow backgroundcolortransparentimportant galeria1686178sliderminitwitter facebookcon elnone galeria205px important height1pxpaddingleft 20px00px galeria168617910px paddingtopseptiembre 2019width14px texttransformdisplayauto height 30pxinformativos200px important2020 informativosenlaces activos cajamenusecciontvestilo1492221 appbloquemarconivel2 appmarcotam2secciones15px margintopfontsize 50pxasecciontv texttransform nonelineheightright 0px margintoppre forvar0px cajacabeceraseccion widthaligncontentappbloquemarcoestructura8p appcontenidodestacadoinformativos textodestacadoinformativosdescdestacadoinformativosmargintop 00px fondoacabeceraseccionhover color 99970pxtop80pxtag httpswww3smartadservercomacsiteid396542fmtid98591ab1tgtoc1outvast4ps1pb3visitsvcnsvphplayerheightvpwplayerwidthvpmt1tmstptimestampgdpr1gdprconsentgdprconsentpgiddespiertasansserif fontweight 100768px mrgenes 2018html html htmlauto29000 textdecorationgaleria155417515px height 270pxfontsize 12px menuseccionfinalblancotv10px menuseccionfinalimportantoffset preclose twitter8pxcolor000 margenesscreen responsivefondo gris f1f3f400pxnuevascolor 999 textdecorationmarginleft 0pxappbloquemarconivel2 appmarcotam2pieheight 195px009539 textdecoration nonetvimportant backgroundcolortransparentfffimportant galeriagaleria1538189fontweight 400 color14pxfontweight300width 45 cabeceraseccionfilete 1galeria1686180 jcidernavimg widthenlaces visitados acabeceraseccionhovernone enlaces visitados600 fontsize 12px118px left 0pxheight 178pxrtva direccin5px backgroundcolorcajacabeceraseccion width 45podcasts galeria1686179slider paddingleft10px paddingbottom200px marginleft 1pxactivos cajamenusecciontv50px acabecerasecciontvlink color0 2px 1px2700px galeria1686178 jcidernavwidth 120pximportant borderimportant galeria149998720pxcorreoenlace acabeceraseccionactivepaddingbottom 10pxbackgroundcolortransparentimportant color000 galeriaminislideshow imgposition relativetexttransform nonecolor 999flexendflamenco galeria1686180sliderblockh2 fontfamily open2px solid 009539galeria1499987 minislideshowlineheight 20px paddingappmarcotam6 h2galeria1446265cajacabalacarta width0px paddingtop 0pxbackgroundcolor ffffontweight 600 fontsizeestilo1301773 appbloquemarconivel2sansserif fontsize26px fontweight 600andaluca elcolor000estefffimportant lineheight 20pxtextalign right texttransformeventstoppropagation contenedorcab widthque150px importantinferior verdemenuseccionmediocolor fff lineheightappmarcotam1 h2cmeteloh2 a fontfamilylineheight 30pxposition relative toppaddingright 10px menuseccionfinalblancotvpaddingrightestilo 2018close768 eventstoppropagation contenedorcabh2diarios colorfff lineheight 19pxsecciones noticiaspodcastscosta100 justifycontentgaleria14999870px borderbottom1686178 radioheight 200px importantmargintop 00px galeria1686178width auto height40pxgaleria1686178 minislideshow imgjustifycontentflexend10px 2018 fondofffimportant galeria 1686179d8d8d8 padding 0aaseccionhover color 999009539 textdecoration underlinetransparent backgroundsizeminislideshow backgroundcolor000importantborderbottom 1px solidh2 a colorpadding 0flexstart cabeceraseccion fontweight45 displayblanco fileteonly screenimportant galeria1686178margintop 5px marginbottomnone5px backgroundcolor fffborderradius 025rem00px media screenblack cajacabecerasecciontv widthjcidernavright displayunderline textdecorationcolor45 display flexmenuseccioncabalacartafinalsolid 0005px 5px 5pxdisplay grid margintoplineheight 32px paddingtopimportant galeria1686180 minislideshow40px importantcolor fff estilo1492221premargintopfffimportant estilo1686351000 padding 0pxheight 40px importantwidth autovictorianone borderbottom 0pxgaleria carnaval 2020aaseccionactiveuppercase paddingleft5urlresourcesarchivosoffline20212281614532411695tramatriangulos2000x3000jpgwidth 150pxfb7f00importantjustifycontent flexstart alignitemsgaleria1417289inlineflex margintopmenuseccioninicioblancotv borderright 1pxfontsize 20pxaqu y28a color f1f3f4galeria1540799 minislideshowpaddingleft 10px paddingtopmunicipalessansserifpaddingtop 10px margenessolid 3f8bcd borderbottomlasurlresourcesarchivosoffline20187251532521440369recurso8svgpaddingbottom 5pxmargintop 15px170px important galeria1639935galeria andaluciasantadiarios10px paddingright 10pxjcidernav jcidernavright displayfontsize 24px colorni100 displayhtml htmlcarta galeria1686178sliderborderright 1px solidminifondoslideshowinfo width9no diarios color5px widthnochenuevacanal surmusicael enlace acabecerasecciontvactivey estilos cajaminfin15px estilo1686351 titulodestacadoinformativosmarginbottom 5pxbackgroundposition96 98aasecciontvvisited colorheight autovisitados acabeceraseccionhover colorespecialactivostitulodestacadoinformativos fontfamily30 de septiembretextodestacadoinformativos titulodestacadoinformativosh2 fontfamilyclassappcontenidonoticia rowapptextonoticia h2backgroundsize 200pxmargintop 10px10px menuseccionfinal borderrightjustifycontentacabeceraseccionactiveappentradillaifandaluciacuteaunderline enlaces activosgaleria 1686180 flamencoheight 270px importantel enlacevisitados aaseccionvisited coloraseccioncabalacarta2px fontsizebackgroundcolor transparent fontfamily000 textdecoration underlinefontsize 30pxvar w mathmaxdocumentdocumentelementclientwidth10px border1px solidcarnaval 2020contenedorcabtv width 100el usuariobackgroundposition90 100 backgroundrepeatad14px texttransform none700 color fff5px paddingbottom 0px12px media screentextdecoration underline elenlace acabecerasecciontvactive colorcolor777 galeria1686178paddingleft 10px paddingrightflamencossansserif fontweight 700solid 313131paddingtop 0pxesta sobre elimportant galeria1686179 sliderminifondorowapptextonoticia30px paddingpodcasts estilo1686351 backgroundimage1686180 flamenco1px solid 009539galeria1535753 minislideshow21px paddingbottomtransparent colorpaddingdisplay flex justifycontentflexendcolorfff marginright28acartagaleria1686178 sliderminifondo0px 0px marginbottom999 textdecorationcultura fondowidth 150px important15px height 178pxwidth 1005px 7pxgaleria1686179 jcidernav jcidernavrightasecciontv fontfamily openbackgroundsize covercon andalucamrgenes 2018 fondo120px importanturlnavidad10px asecciontvenlaces activos menuseccioniniciodocument clickfunctionsansmenuseccioninicio borderright 1pxdisplay none galeriagaleria1686180 jcidernav jcidernavrightgris 28agaleria1417289 minislideshow32pxcarta noticiaswidth 100 justifycontentmargenes cajadescdestacadoinformativos fontfamilybackgroundsize 70pximg width 205pxblanco pie15px paddingbottom 0pxuppercase menusecciondirectobackgroundimage urlresourcesarchivosoffline20194101554917231136eleccionesgeneraleslogo28asvg0 7px paddingbottom70px marginleft 1pxandalucia de cercamaxwidth 768pxsuacabeceraseccionlink color10n12px mediainformativos no diariosopen sans768px mrgenescompromiso con andalucalineheight 19pxw 768 eventstoppropagationbackgroundsize 200px marginleftsolid 009539importantflex aligncontent flexstartcolor e63027009539 padding20px paddingtoppaddingleft 10px21pxmenuseccionmedio borderright 1px8none menuseccioninicioblancotvtitulodestacadoinformativos fontfamily opentextdecoration underlinefontsize18px color313131paddingtop 6px paddingleftjcidernavright display block52905apx colorgaleria1686178 jcidernav jcidernavlefttexttransform none menuseccioninicioblancotv14px color fffmargintop 15px marginbottomcine canal surfff textdecoration none195pxcajatxtandaluciadecercaprovincialesmarginleft 1px100 cajamenusecciontv700 colorlineheight 20px30px padding 5px3seimagenesmargintop 00pxpaddingtop 10px 2018width auto topmarginleftauto height40px1px solid 313131black cajacabecerasecciontvjustifycontent flexstart cabeceraseccionbackgroundcolor000importantappbloquemarcoestructura8p classappcontenidonoticiafontsize18px colore63027 marginrightflexstart cabeceraseccion0px paddingrightfontsize 12px mediasur radio0px cabecerasecciontv fontweightmanof1f3f4 backgroundsizef1f3f4 filete superiorligacolor000 margenes cajacontenedorcabalacarta widthfacebook whatsappborderbottom 0px solidpaddingbottom 0pxgaleria1686180slider paddingleft 15px195px important98 backgroundrepeat norepeat2px fontsize 12pxdcdcdc soliddisplay inlineflex margintop175pxmarginright autogaleria1500052 minislideshowfontweight 100fontsizegaleria1301919 minislideshowfilete superiornone color 009539cajaredesincollapsehide cajaredespadding 10pxestaacutenmargintop 00px mediawidth 65 displaycolor777 galeria1686178 jcidernavaaseccionvisited color26mcabecerasecciontv fontweight 100768 eventstoppropagationestilo 2018 fondo00px galeria2px solid 3f8bcd7px estilo1686351 appmarcotam4televisionmenuseccionmediotop50cfiesta0px solidgaleria170354410px backgroundcolor blackfondo podcastsclickfunction cajaredesincollapsehide cajaredes00px galeria1686179 jcidernavestilo1516620auto width auto14px texttransform initialcajamenuseccion margintop 5pxbackgroundrepeatcolor 777textodestacadoinformativos titulodestacadoinformativos fontfamily0px solid d8d8d8display inlineflexfff lineheight 18pxcine canalcolor f1f3f4 estilo1686351backgroundal1px solid fffcolor dcdcdc textdecoration237px paddingbottom5px estilo149222100px galeria 1686180jcidernavimportant galeria1686179 minislideshowgaleria1686179sliderminivisitados aasecciontvvisited color30px paddingbottomlos programasgaleria1686179 jcidernavsans sansserif fontsizetalentobackgroundcolorfff importantcanal sur producesansserif fontweightflamencoacabeceraseccionlinkgaleria1639935 minislideshowpaddingright 10px aseccion16px color fffimportantdivcontainerespecialtvelshowdebertinpaddingleftlo masusuario estaopen sans sansserifnorepeat backgroundsizebackground urlresourcesarchivosoffline20187251532521440369recurso8svg 1pxmarginright 1pxvisitados aasecciontvvisited100 cajamenuseccion margintopurlpimportant galeria1686179portalappmarcotam11px colore inferiorcanal sur conbackgroundcolortransparentimportant galeria1686178slidermini2018 fondo blancoaudiof1f3f4 bordertopgaleria1381003color f1f3f4 filetebackgroundsize cover marginleft00px mediaestilosjcidernavleft displaygaleria1686180 minislideshow minifondoslideshowinfow mathmaxdocumentdocumentelementclientwidthestilo1686351 paddingtop 0px22px80px important backgroundcolortransparentimportant1px color 009539initial borderbottom 1pxestilo 2020 informativossur produce canallineheight 18px paddingmasenlaces no visitadosborderradius 5pxborder 000 solidgaleria153575328a fondo grisgaleria170345915px height 170pxiniciogethoursgaleria15505450px marginbottomnorepeat backgroundsize covercajacabecerasecciontv width 45nogaleria1686179 minislideshowgaleria1686178padding 0 0enlace aaseccionactive colorenlaces visitados aasecciontvhoverheight 210px important210px importantvuelve15px heightmathmaxdocumentdocumentelementclientwidth windowinnerwidth 0noticias deportesenlaces activosgaleria1686178slider400 fontsizeespaa40pxwbackgroundcolortransparentimportant height 175px120pximportant border 00016pxfffimportantenlaces visitados acabecerasecciontvhoverbackgroundcolor fff widthbarraprovincias24pxsevilla000 paddingtop 5pxtextdecorationrightfontweight 600 paddingrightgris 28a colorvisitados aaseccionhovernew2020 fondo2020 semifinal52905a 20191 px colorinitialwidth 250pxestilos caja estilo17cajacabecerasecciontvcolorfff galerialista28a fondobackgroundcolor black cajacabecerasecciontvappcontenidodestacadoinformativoscolor313131 marginright 2px230pxgaleria1550547 minislideshowcajacabecerasecciondescdestacadoinformativos fontfamily opencajamenuseccion widthappcintillonoticia fontfamilymenusecciontvacabecerasecciontvlinkbackgroundsize containcontenedorcabalacarta width 100tierra de talento1px backgroundcolor 000img29 de septiembrepaddingtop 10px border1pxoffset pre forvarasecciondisplay inlineflex justifycontentpaddingtop 5px paddingbottom5px paddingbottomhosteleriacuteadelcolore63027 marginrightmargintop 5px paddingbottom205pxgaleria1418171 minislideshowmarginbottom 20px paddingtopbackgroundposition bottom backgroundrepeatheight 175px important0px paddingtopappentradilla fontfamily open15px marginbottom2019 fondocolor fffimportant galeria10px borderradiusgaleria1550546 minislideshowborderright 1px100 fontsize 21pxpaddingbottom 5px widthwidth 220px importantaasecciontvvisitedimportant backgroundcolortransparentimportant7px estilo1686351important galeria1381003contenedorcabaasecciontvlink color fffimagenes color f1f3f4backgroundcolortransparentimportant color000appmarcotam5backgroundcolortransparent colorfffwhatsappimagenes colorgaleria1686180 sliderminifondo paddingleftbertnpaddingbottom 5px acabeceraseccionlinkd8d8d8 paddingmenuseccioninicioblancotv borderrightmenuseccion fontweight 600190px margintop 00pxfontsize 26pxbackgroundcolortransparent color7771px galeria1686178 minislideshow120px important height1px backgroundcolor26px fontweightpaddingtop 0px paddingbottomgaleria1686178 minislideshow backgroundcolortransparentimportantclickfunctionevent var10px 201819pxfontweight300 fontsize10px aseccionpaddingbottom 15px estilo16863511px marginrightestilo1686351 appbloquemarcoestructura8p appcontenidodestacadoinformativospaddingleft 0px widthmasprogramasaasecciontvactiveheight 170pxgaleria1653933texttransform uppercase menusecciontvacabeceraseccionactive color 999backgroundcolortransparentimportantlos24px paddingtop2px solid fb7f00importantestafontsize 14px texttransformopen sans fontweightaaseccionhover colorauto width0px aseccioncabalacarta600 fontsize 14px600 paddingright 10pxel show15px marginbottom 10pxmenuseccioniniciofechavideo150pxenlacesfondo podcasts estilo1686351flexstart100 justifycontent flexstartestilo1504530none enlacescabecerasecciontvwidth 4511height 170px importantmarginleft 1px marginright14px color fffimportantif w 768cabeceraseccion fontfamily openbackgroundcolor f1f3f4 backgroundsizepaddingright 10pxtexttransform100 cajamenuseccionsansserif fontweight300canal sur radiotagcajaredesincollapsehide cajaredes clickfunctioneventnoticias provincialesheight 300px important52905a 2019 elecciones200px5px 0 7pxacabecerasecciontvactive colorfacebookmenuseccion fontweightcover marginleft 1pxcompromiso50px paddingbottommorenouppercasemargenes caja estilogaleria1686180 minislideshow imgnorepeat backgroundcolor f1f3f4solid d8d8d8 paddingwidth 300px importantwhatsapp correo andaluca000 paddingimportant galeria1639935 minislideshowrelative topuppercase aasecciontvlinkprovinciagaleria1686178slider paddingleft 15px195px important galeria1686179fontweight 600acabeceraseccionlink color 009539schedule tag313131 paddingleft 0pxestilo1686351 backgroundimagejcidernavright display nonecomo777 textdecoration none5px margintopvisitados acabeceraseccionhoverwidth 205px28bandajcidernavleft display noneaaseccionvisitedenlaces visitadosmenuseccionfinalpaddingbottomdisplay gridfontsize 12px0px paddingbottom0px paddingbottom 0pxahoracolor313131 marginrightcdiz00px galeria1686178comunicacintop 50galeria1686178 minislideshowwidget programacionfontweightaasecciontvhoveraasecciontvvisited color fffgaleria1686178 jcidernavwidth 175px importantpaddingbottom 30px borderbottomwhatsapp correopapeletaheight 250px5px 0galeria1686179 minislideshow imgflex alignitemsfffimportant estilo1686351 appbloquemarcoestructura8pestilo1492221 appcintillonoticiaprogramacionschedule tag httpswww3smartadservercomacsiteid396542fmtid98591ab1tgtoc1outvast4ps1pb3visitsvcnsvphplayerheightvpwplayerwidthvpmt1tmstptimestampgdpr1gdprconsentgdprconsentpgid400 colorblock right 0px18pxmaacutes100 fontsizegaleria1653897 minislideshowbackgroundposition rightmathmaxdocumentdocumentelementclientwidth0 0backgroundcolorfff important galeria1381003portadaprovincialesfondo 2018 fondo400 fontsize 16px1d8d8d8h2 a appbloquemarconivel210px menuseccioninicioblancotv borderrightheight 30pxradiofontsize 50px paddingbottom12px asecciontv texttransform10px aseccion fontfamilyestilo1686351 titulodestacadoinformativos fontfamilypaddingleft 15px heightestilocultura fondo griswidth 200pximportantgaleria1550545 minislideshowtransparent marginleft10px cajacabeceraseccion widthcon la culturaestilo 2020 fondo0 2px5px solid e63027galeria1554175 minislideshow00px fondo podcastspie inferiorgaleria1686178sliderminiimportant galeria1639935aseccion texttransform none768px contenedorcabtv widthheight 210pxflexend paddingbottom300px important heightviernes768pxacabeceraseccionactive coloraseccion texttransform5px acabeceraseccionlink colormenuseccioninicioblancotvvisitados acabecerasecciontvvisited30px paddingbottom 5px00 7pxuppercase aaseccionlink colorappbloquemarconivel2 appmarcotam1 h2margintop 20px marginbottom118px leftflexstart alignitems10px asecciontv fontfamilyheight 260pxbordertop 2pxtexttransform uppercase5px 5pxfontweight 400 fontsizeenlaces activos cajamenuseccionbackgroundsize 70px marginleftsolid dcdcdcnorepeattexttransform uppercase menuseccion250px importantsuperiorscreen and mindevicewidthtextdecoration none enlaces20px fontweight 400height 270pxheight 80pxacabecerasecciontvlink colorappbloquemarcoestructura8p appcontenidodestacadoinformativoswidth 250px importantgaleria1686180slidermini backgroundcolortransparentimportant heightsolid 009539 margenesgaleria1686179 minislideshow backgroundcolortransparentimportant28a colorinlineflex margintop 15pxpaddingbottom 0px marginbottom2018 fondo 2018minifondoslideshowinfo width 205pxschedulecontenedorcab widthrelativefontsize 14px lineheightfilete superior elanzadordirectoradiocabecerasecciontv fontweight1px marginright 1px10px menuseccionmedioblancotveventstoppropagation contenedorcablisolid fb7f00important5px 5px 05px solidcolor dcdcdcnorepeat importantgaleria1540329appantetitulonoticia fontfamily openmenuseccioncabpodcastsfinal000 paddingtop 10pxcajaredes clickfunctionevent vartextdecoration underline enlacesbackgroundcolorfffcolor f1f3f4 piegaleria1686180alignitems flexend menuseccioninicioproduce canal15px height 250pxbarraprovincias ulgaleria1686179slider paddingleft 15pximportant heightrecuadro filete 1correo document clickfunction15px paddingbottom80px important backgroundcolortransparentborder1px solid3f8bcd borderbottomacabeceraseccionvisitedprimera000 lineheight 19pxsolid 52905a 2019backgroundcolortransparentimportant galeria1686179slidermini backgroundcolortransparentimportant0px importantcolor 009539 textdecorationvisitados aaseccionhover colorbackgroundcolortransparent heightimportant height 0pxcolor000 galeria andaluciacontenedorcabtvjustifycontentflexend alignitems009539 margenesbottom313131 paddingleftnoticiasbackgroundcolortransparent color777 galeria1686178display flexcajamenuseccionappmarcotam2 h210px border1pxasecciontv fontfamilyminifondoslideshowinfo width 200pxurlpublivideo

Longtail Keyword Density for Canalsur.es

KeywordsOccurences
font-family open sans105
open sans sans-serif97
padding-left 15px height85
-------media screen responsive------81
sans sans-serif font-weight79
1px margin-right 1px69
margin-left 1px margin-right69
minislideshow img width60
minislideshow minifondoslideshowinfo width58
responsive------ -------media screen57
screen responsive------ -------media57
text-decoration none enlaces56
compartir close twitter40
close twitter facebook40
twitter facebook whatsapp40
facebook whatsapp correo40
margin-right 1px padding-top39
color 009539 text-decoration37
font-weight 100 font-size37
1px padding-top 10px37
important background-colortransparent color00035
border-bottom 2px solid33
width 100 display31
font-weight 600 font-size30
enlaces no visitados28
usuario esta sobre28
solid 313131 padding-left28
height 170px important28
sobre el enlace28
esta sobre el28
el usuario esta28
margin-right 1px margin-bottom27
none enlaces no27
none enlaces visitados27
important height 0px26
0px important background-colortransparent26
height 0px important26
padding-top 15px padding-bottom25
padding-left 10px padding-right25
text-decoration underline el25
underline el usuario25
underline enlaces activos25
text-decoration underline enlaces25
009539 text-decoration none24
999 text-decoration underline24
screen responsive------ media24
responsive------ media screen24
screen and max-width24
border-right 1px solid24
color 999 text-decoration24
20px padding-top 15px23
1px margin-bottom 20px23
padding-top 10px background-color23
font-weight 400 font-size23
margin-bottom 20px padding-top23
color fff text-decoration22
10px padding-right 10px22
sans-serif font-weight 40021
important height 80px21
height 80px important21
sans-serif font-weight 10020
margenes y estilos20
sans-serif font-weight 60020
fff text-decoration none20
width 300px important20
caja estilo 202019
1px solid 31313119
313131 padding-left 10px19
important background-colortransparentimportant color00019
mathmaxdocumentdocumentelementclientwidth windowinnerwidth 018
w 768 eventstoppropagation18
width 205px important18
windowinnerwidth 0 if18
100 font-size 30px18
cajaredes clickfunctionevent var18
w mathmaxdocumentdocumentelementclientwidth windowinnerwidth18
margin-right 2px font-size18
0 if w18
clickfunctionevent var w18
cajaredesincollapsehide cajaredes clickfunctionevent18
clickfunction cajaredesincollapsehide cajaredes18
if w 76818
sliderminifondo padding-left 15px18
var w mathmaxdocumentdocumentelementclientwidth18
2px font-size 12px18
document clickfunction cajaredesincollapsehide18
100 display inline-flex17
600 font-size 14px17
font-weight 700 font-size17
sans-serif font-weight 70017
estilos caja estilo16
700 font-size 14px16
background-colortransparent color000 galeria16
height 40px important16
important height 40px16
img width 300px16
background-colortransparentimportant color000 galeria16
y estilos caja16
40px important background-colortransparentimportant15
height 175px important15
jcider-nav jcider-nav-left display15
jcider-nav jcider-nav-right display15
font-size 14px line-height14
width 220px important14
15px height 170px14
display inline-flex margin-top14
padding 5px 5px14
color fff line-height14
width auto height14
300px important height14
minifondoslideshowinfo width 300px14
sans sans-serif font-size13
width 65 display13
80px important background-colortransparent13
009539 text-decoration underline13
background-repeat no-repeat background-color13
margenes caja estilo13
color fffimportant line-height13
color 777 text-decoration13
font-size 14px text-transform13
border-right 0px solid13
14px line-height 16px13
line-height 16px text-align13
100 display grid13
16px text-align right13
font-size 14px color13
10px background-color f1f3f412
15px padding-bottom 0px12
estilo 2020 fondo12
height 178px important12
65 display flex12
flex justify-contentflex-end align-items12
display flex justify-contentflex-end12
padding-left 0px padding-right12
0px padding-right 10px12
height 250px important12
15px height 250px12
15px padding-bottom 30px11
padding-bottom 30px border-bottom11
30px border-bottom 2px11
display grid margin-top11
width 240px important11
jcider-nav-right display block11
2px solid 52905a11
elecciones generales 28a11
2019 elecciones generales11
display block left11
29 de septiembre11
jcider-nav-left display block11
display block right11
block right 0px11
right text-transform uppercase11
right 0px margin-top11
appbloquemarconivel2 appmarcotam2 h211
h2 a color11
text-align right text-transform11
100 font-size 50px11
justify-contentflex-end align-items flex-end11
0px solid 31313111
5px text-transform uppercase10
border-bottom 0px solid10
600 font-size 12px10
titulodestacadoinformativos font-family open10
5px 0 7px10
padding-bottom 5px text-transform10
30px padding-bottom 5px10
font-size 30px padding-bottom10
5px 5px 010
padding 0px 0px10
contenedorcab width 10010
canal sur produce10
15px height 175px10
14px text-transform none10
12px -------media screen10
font-size 12px -------media10
block left 15px9
padding-bottom 0px border-bottom9
100 justify-content flex-start9
padding 0 09
img width 120pximportant9
caja estilo 2209
400 font-size 14px9
solid fff padding-left9
175px important galeria16861789
generales 28a fondo9
205px important height9
minifondoslideshowinfo width 205px9
img width 205px9
left 15px margin-top9
width 120px important9
minifondoslideshowinfo width 120px9
15px margin-top 00px9
font-size 20px font-weight9
width 100 justify-content9
width 120pximportant border9
30 de septiembre9
background-color transparent font-family9
0px margin-top 00px9
777 text-decoration none9
313131 padding-left 0px9
transparent font-family open9
120px important height9
fondo gris color8
gris color f1f3f48
grid margin-top 0px8
5px width 1008
10px background-color black8
andalucia de cerca8
0 0 2px8
0 2px 1px8
2px 1px color8
appcintillonoticia font-family open8
14px color fff8
colorfff margin-right 2px8
contenedorcabtv width 1008
font-size18px colorfff margin-right8
solid 52905a 20198
52905a 2019 elecciones8
margin-top 5px width8
2018 fondo 20188
100 background-repeat no-repeat8
no-repeat background-color f1f3f48
15px height 178px8
50px padding-bottom 5px7
f1f3f4 margin-left 1px7
font-weight 700 color7
font-size 50px padding-bottom7
width 200px important7
0px border-bottom 2px7
background-color f1f3f4 margin-left7
border-bottom 1px solid7
background-color f1f3f4 border-bottom7
15px height 260px7
carta noticias provinciales7
height 260px important7
img width 220px7
220px important height7
0px margin-bottom 5px7
background-colortransparent height 170px7
mrgenes 2018 fondo6
195px important galeria16861796
20px padding 5px6
appantetitulonoticia font-family open6
font-size 30px color6
font-size 16px color6
400 font-size 16px6
height 195px important6
fff padding-left 10px6
240px important height6
line-height 20px padding6
padding-bottom 5px width6
0px 0px margin-bottom6
height 220px important6
1px solid fff6
padding-top 0px padding-bottom6
200px important height6
minifondoslideshowinfo width 200px6
border-top 2px solid6
2px solid 3f8bcd6
border 000 solid6
120pximportant border 0006
el enlace acabeceraseccionactive6
important galeria1686179 minislideshow6
padding-top 10px padding-bottom6
0px margin-bottom 0px6
enlace acabeceraseccionactive color6
color 000 line-height6
acabeceraseccionactive color 9996
15px margin-bottom 10px6
important galeria1686180 minislideshow6
canal sur con6
margin-top 15px margin-bottom6
h2 a appmarcotam46
tarde aqu y6
background-color f1f3f4 background-size6
height 230px important6
sans-serif font-size 20px6
100 font-size 21px6
important galeria1686178 minislideshow6
inline-flex margin-top 15px6
height 200px important6
minifondoslideshowinfo width 240px6
15px height 230px6
200px important galeria16861806
h2 a appmarcotam35
img width 200pximportant5
80px important background-colortransparentimportant5
acabeceraseccionlink color 0095395
height 300px important5
no visitados acabeceraseccionvisited5
15px height 300px5
acabeceraseccionhover color 9995
visitados acabeceraseccionvisited color5
5px background-color fff5
acabeceraseccionvisited color 0095395
bottom background-repeat no-repeat5
color000 galeria andalucia5
visitados acabeceraseccionhover color5
enlaces visitados acabeceraseccionhover5
5px width auto5
margin-bottom 0px padding-top5
img width 240px5
margin-bottom 10px cajacabeceraseccion5
10px cajacabeceraseccion width5
cajacabeceraseccion width 455
border-radius 5px background-color5
45 cabeceraseccion font-family5
cabeceraseccion font-family open5
h2 a appmarcotam85
h2 a appmarcotam65
h2 a appmarcotam55
enlaces activos cajamenuseccion5
2px solid 009539important5
28a fondo gris5
canal sur radio5
2018 en imagenes5
galeria carnaval 20205
color000 galeria carnaval5
imagenes color f1f3f45
media only screen5
width 45 cabeceraseccion5
width 100 cajamenuseccion5
activos cajamenuseccion width5
font-size 26px font-weight5
24px padding-top 5px5
aseccion text-transform none5
visitados aaseccionhover color5
aaseccionhover color 9995
h2 a font-family5
12px aseccion text-transform5
font-size 12px aseccion5
cajamenuseccion width 655
color 000 text-decoration5
menuseccion font-weight 6005
el enlace aaseccionactive5
enlace aaseccionactive color5
appentradilla font-family open5
padding-right 10px aseccion5
line-height 24px padding-top5
10px aseccion font-family5
text-transform none border-bottom5
enlaces visitados aaseccionhover5
text-transform uppercase aaseccionlink5
uppercase aaseccionlink color5
aaseccionlink color 0095395
no visitados aaseccionvisited5
visitados aaseccionvisited color5
aaseccionvisited color 0095395
0px solid d8d8d85
20px font-weight 7005
solid d8d8d8 padding5
d8d8d8 padding 05
text-transform none color5
background-colortransparentimportant height 175px5
appmarcotam2 h2 font-family5
h2 font-family open5
aseccion font-family open5
menuseccionfinal border-right 0px5
none border-bottom 0px5
f1f3f4 border-bottom 2px5
menuseccionmedio border-right 1px5
menuseccioninicio border-right 1px5
padding-right 10px menuseccionmedio5
menuseccioninicio i font-size18px5
10px menuseccionmedio border-right5
margin-top 0px cajacabeceraseccion5
0px cajacabeceraseccion width5
cajacabeceraseccion width 1005
2px solid 0095395
100 cajamenuseccion margin-top5
cajamenuseccion margin-top 5px5
justify-content flex-start cabeceraseccion5
font-size18px color313131 margin-right5
flex-start cabeceraseccion font-weight5
divdescripciontextoelshowdebertin font-size 20px5
cabeceraseccion font-weight 1005
padding-right 10px menuseccionfinal5
color313131 margin-right 2px5
10px menuseccionfinal border-right5
0px padding-bottom 0px5
enlaces activos menuseccioninicio5
000 text-decoration underline5
aaseccionactive color 9995
15px height 220px4
auto width auto4
color 000 padding-top4
5px acabeceraseccionlink color4
align-items flex-end menuseccioninicio4
font-weight 400 line-height4
padding-left 15px padding-right4
escuchar en directo4
screen and min-device-width4
padding-bottom 0px margin-bottom4
width 175px important4
auto top 118px4
padding-bottom 5px acabeceraseccionlink4
background-position90 100 background-repeat4
70px margin-left 1px4
background-size 70px margin-left4
width auto top4
background-position96 100 background-repeat4
open sans font-weight4
28a fondo blanco4
flex-end menuseccioninicio border-right4
jcider-nav-left display none4
background-repeat no-repeat background-size4
max-width 768px contenedorcab4
768px contenedorcab width4
text-transform uppercase menuseccion4
barraprovincias ul li4
whatsapp correo andaluca4
18px padding 5px4
uppercase padding-left 0px4
line-height 18px padding4
textodestacadoinformativos titulodestacadoinformativos font-family4
appcontenidodestacadoinformativos textodestacadoinformativos titulodestacadoinformativos4
appbloquemarcoestructura8p appcontenidodestacadoinformativos textodestacadoinformativos4
important galeria1639935 minislideshow4
margin-top 0px margin-bottom4
uppercase menuseccion font-weight4
text-transform uppercase padding-left4
padding-left 0px width4
fondo gris 28a4
top 118px left4
gris 28a color4
todos los programas4
28a color f1f3f44
jcider-nav-right display none4
padding-top 10px border-radius4
10px border-radius 5px4
color000 galeria elecciones4
text-decoration underline text-decoration-color4
galeria elecciones 26m4
width auto height40px4
septiembre 2019 fondo4
line-height 19px important4
width 250px important4
0px width auto4
000 padding-top 5px4
118px left 0px4
carnaval 2020 semifinal4
10px padding-bottom 15px4
background-color f1f3f4 border-top4
5px 5px 7px4
777 text-decoration underline4
color fff estilo13017734
fff line-height 19px4
2020 fondo gris4
f1f3f4 filete superior4
color dcdcdc text-decoration4
descdestacadoinformativos font-family open4
urlresourcesarchivosoffline20187251532521440369recurso8svg 1px 5px4
2020 fondo blanco4
solid 009539 margenes4
009539 margenes y4
border-bottom 5px solid4
fondo gris f1f3f44
estilo 220 fondo4
5px 5px 5px4
21px padding-bottom 5px4
15px height 195px4
none color 0095394
background urlresourcesarchivosoffline20187251532521440369recurso8svg 1px4
5px no-repeat important4
no-repeat important font-weight4
important font-weight 6004
1px color 0095394
color 009539 estilo14922214
background-position bottom background-repeat4
font-size 21px padding-bottom4
fffimportant line-height 24px4
sans-serif font-size 26px4
font-weight 600 color4
000 solid 1px4
15px height 200px4
contenedorcabalacarta width 1004
line-height 30px padding4
con la cultura4
1px 5px no-repeat4
align-items flex-end padding-bottom4
width 150px important4
flex-end padding-bottom 10px4
15px height 210px4
2018 fondo blanco4
fffimportant line-height 20px4
height 210px important4
16px color fffimportant4
height 270px important4
10px padding-top 10px4
15px height 270px4
padding-left 10px padding-top4
margin-bottom 10px background-color4
313131 padding 0px4
recuadro filete 14
filete 1 px4
h2 a appbloquemarconivel24
color 313131 padding4
1 px color4
30px color 3131314
appbloquemarconivel2 appmarcotam1 h24
sur produce canal4
solid 009539important margenes4
produce canal sur4
margin-bottom 5px margin-top4
aqu y ahora4
max-width 768px mrgenes3
768px mrgenes 20183
color f1f3f4 estilo16863513
f1f3f4 estilo1686351 padding-top3
estilo1686351 padding-top 0px3
padding-top 5px padding-bottom3
galeria1686180 jcider-nav jcider-nav-right3
00px -------media screen3
margin-top 00px -------media3
20px font-weight 4003
color 000 padding3
00px galeria1686180 jcider-nav3
correo a toda3
5px solid e630273
sans sans-serif font-weight3003
margin-top 00px galeria16861803
galeria1686180 jcider-nav jcider-nav-left3
000 padding 0px3
galeria1686180 minislideshow minifondoslideshowinfo3
galeria1686180slidermini background-colortransparentimportant height3
margin-bottom 0px color3
inline-flex margin-top 0px3
0px color fffimportant3
offset pre forvar3
align-content flex-start align-items3
flex align-content flex-start3
display flex align-content3
no-repeat background-position right3
000 line-height 19px3
position relative top3
transparent color 0095393
colore63027 margin-right 2px3
font-size18px colore63027 margin-right3
forvar i 13
margin-left auto width3
auto margin-bottom 20px3
schedule tag httpswww3smartadservercomacsiteid396542fmtid98591ab1tgtoc1outvast4ps1pb3visitsvcnsvphplayer-heightvpwplayer-widthvpmt1tmstptimestampgdpr1gdprconsentgdprconsentpgid3
max-width 768px contenedorcabtv3
divcontainerespecialtvelshowdebertin margin-top auto3
175px important galeria16861803
175px important galeria16861793
directo en directo3
10px padding-right 0px3
auto height 30px3
background-repeat no-repeat background-position3
fff line-height 18px3
estilo1686351 appbloquemarcoestructura8p appcontenidodestacadoinformativos3
fffimportant estilo1686351 appbloquemarcoestructura8p3
color fffimportant estilo16863513
768px contenedorcabtv width3
var schedule tag3
minislideshow background-colortransparentimportant galeria1686178slidermini3
sans-serif font-weight300 font-size3
galeria 1686179 podcasts3
7px estilo1686351 appmarcotam43
estilo1686351 appmarcotam4 h23
color fffimportant galeria3
fffimportant galeria 16861793
galeria1686178 jcider-nav jcider-nav-left3
color777 galeria1686178 jcider-nav3
1686179 podcasts galeria1686179slider3
estilo1686351 titulodestacadoinformativos font-family3
podcasts galeria1686179slider padding-left3
galeria1686179slider padding-left 15px3
background-colortransparent color777 galeria16861783
important background-colortransparent color7773
important galeria1686179 sliderminifondo3
galeria1686179 sliderminifondo padding-left3
0 7px estilo16863513
15px estilo1686351 titulodestacadoinformativos3
minislideshow background-colortransparentimportant galeria1686179slidermini3
no-repeat background-size cover3
margin-top 00px fondo3
00px fondo podcasts3
galeria1686178 jcider-nav jcider-nav-right3
fondo podcasts estilo16863513
podcasts estilo1686351 background-image3
estilo1686351 background-image urlresourcesarchivosoffline20212281614532411695trama-triangulos-2000x3000jpg3
background-size cover margin-left3
padding-bottom 15px estilo16863513
cover margin-left 1px3
margin-right 1px background-color3
1px background-color 0003
background-color 000 padding-top3
00px galeria1686178 jcider-nav3
margin-top 00px galeria16861783
000 padding-top 10px3
galeria1686179 minislideshow background-colortransparentimportant3
background-colortransparentimportant galeria1686179slidermini background-colortransparentimportant3
galeria 1686178 radio3
border dcdcdc solid3
galeria1686178slidermini background-colortransparentimportant height3
background-colortransparentimportant galeria1686178slidermini background-colortransparentimportant3
galeria1686178 minislideshow background-colortransparentimportant3
1px galeria1686178 minislideshow3
solid 1px galeria16861783
dcdcdc solid 1px3
120pximportant border dcdcdc3
galeria1686178 minislideshow minifondoslideshowinfo3
galeria1686178 minislideshow img3
galeria1686178 sliderminifondo padding-left3
important galeria1686178 sliderminifondo3
background-colortransparentimportant galeria1686180slidermini background-colortransparentimportant3
galeria1686178slider padding-left 15px3
carta galeria1686178slider padding-left3
minislideshow background-colortransparentimportant galeria1686180slidermini3
galeria1686180 minislideshow background-colortransparentimportant3
galeria1686179slidermini background-colortransparentimportant height3
00px galeria 16861803
galeria1686179 minislideshow minifondoslideshowinfo3
galeria1686179 jcider-nav jcider-nav-left3
margin-top 00px galeria16861793
00px galeria1686179 jcider-nav3
galeria1686179 jcider-nav jcider-nav-right3
margin-top 00px galeria3
galeria 1686180 flamenco3
1px galeria1686180 minislideshow3
1686180 flamenco galeria1686180slider3
flamenco galeria1686180slider padding-left3
galeria1686180slider padding-left 15px3
important galeria1686180 sliderminifondo3
galeria1686180 sliderminifondo padding-left3
galeria1686180 minislideshow img3
solid 1px galeria16861803
galeria1686179 minislideshow img3
show de bertn3
170px important galeria16399353
font-size 12px menuseccionfinalblancotv3
32px padding-top 5px3
line-height 32px padding-top3
26px font-weight 6003
padding-top 5px estilo14922213
700 color fffimportant3
estilo1492221 appbloquemarconivel2 appmarcotam23
estilo1492221 appcintillonoticia font-family3
menuseccionfinalblancotv i font-size18px3
menuseccioninicioblancotv i font-size18px3
14px text-transform initial3
enlaces activos menuseccioninicioblancotv3
aasecciontvactive color 0095393
enlace aasecciontvactive color3
el enlace aasecciontvactive3
aasecciontvhover color 0095393
visitados aasecciontvhover color3
enlaces visitados aasecciontvhover3
aasecciontvvisited color fff3
visitados aasecciontvvisited color3
14px color fffimportant3
text-transform initial border-bottom3
aasecciontvlink color fff3
1px color fff3
2020 fondo informativos3
fondo blanco pie3
pie inferior verde3
f1f3f4 pie inferior3
color f1f3f4 pie3
2px solid 0003
f1f3f4 border-top 2px3
color f1f3f4 filete3
700 color fff3
estilo1301773 margin-left 1px3
initial border-bottom 1px3
color fff estilo14922213
7px padding-bottom 10px3
0 7px padding-bottom3
30px padding 5px3
font-size 24px color3
400 font-size 24px3
009539 padding 03
solid 009539 padding3
1px solid 0095393
no visitados aasecciontvvisited3
uppercase aasecciontvlink color3
informativos no diarios3
flex align-items flex-end3
visitados acabecerasecciontvvisited color3
no visitados acabecerasecciontvvisited3
acabecerasecciontvlink color fff3
50px acabecerasecciontvlink color3
font-size 50px acabecerasecciontvlink3
cabecerasecciontv font-family open3
flex-end cabecerasecciontv font-family3
align-items flex-end cabecerasecciontv3
display flex align-items3
enlaces visitados acabecerasecciontvhover3
45 display flex3
width 45 display3
cajacabecerasecciontv width 453
black cajacabecerasecciontv width3
background-color black cajacabecerasecciontv3
margin-top 5px margin-bottom3
cine canal sur3
portal de transparencia3
tierra de talento3
acabecerasecciontvvisited color fff3
visitados acabecerasecciontvhover color3
text-transform uppercase aasecciontvlink3
padding-right 10px menuseccionmedioblancotv3
asecciontv font-family open3
10px asecciontv font-family3
padding-right 10px asecciontv3
0px solid fff3
menuseccionfinalblancotv border-right 0px3
10px menuseccionfinalblancotv border-right3
padding-right 10px menuseccionfinalblancotv3
menuseccionmedioblancotv border-right 1px3
10px menuseccionmedioblancotv border-right3
fff padding-left 0px3
acabecerasecciontvhover color 0095393
menuseccioninicioblancotv border-right 1px3
10px menuseccioninicioblancotv border-right3
padding-bottom 10px menuseccioninicioblancotv3
cajamenusecciontv width 653
activos cajamenusecciontv width3
enlaces activos cajamenusecciontv3
acabecerasecciontvactive color 0095393
enlace acabecerasecciontvactive color3
el enlace acabecerasecciontvactive3
fondo informativos no3
no diarios color3
margin-top 20px margin-bottom3
menusecciontv font-weight 6003
rsc compromiso con3
h2 a font-size3
400 color fff3
font-weight 400 color3
text-transform none menuseccioninicioblancotv3
asecciontv text-transform none3
12px asecciontv text-transform3
font-size 12px asecciontv3
uppercase menusecciontv font-weight3
font-weight 600 padding-right3
text-transform uppercase menusecciontv3
30px text-transform uppercase3
font-size 30px text-transform3
cabecerasecciontv font-weight 1003
0px cabecerasecciontv font-weight3
padding-bottom 0px cabecerasecciontv3
5px padding-bottom 0px3
margin-top 5px padding-bottom3
inherit margin-top 5px3
compromiso con andaluca3
600 padding-right 10px3
flex-start align-items inherit3
solid 3f8bcd border-bottom3
inline-flex margin-top 20px3
170px important galeria17035443
220px important galeria17034593
background-colortransparentimportant height 170px3
170px important galeria16399383
display none galeria3
220px important galeria16399353
fondo blanco filete3
3f8bcd border-bottom 2px3
e inferior azul3
html html html3
superior e inferior3
filete superior e3
estilo 2020 informativos3
correo document clickfunction3
whatsapp correo document3
correo andaluca directo3
underline text-decoration-color 0095393
eventstoppropagation contenedorcab width3
768 eventstoppropagation contenedorcab3
align-items inherit margin-top3
justify-content flex-start align-items3
color000 margenes caja3
transparent margin-left 1px3
10px margenes caja3
padding-top 10px margenes3
color fff cajatxtandaluciadecercaprovinciales3
padding-top 6px padding-left3
background-colortransparentimportant height 178px3
1px margin-bottom 0px3
2px solid fb7f00important3
220 fondo blanco3
background-color transparent margin-left3
estilo 2018 fondo3
lo mas viral3
cultura fondo gris3
009539important margenes caja3
200px margin-left 1px3
background-size 200px margin-left3
98 background-repeat no-repeat3
background-position96 98 background-repeat3
urlresourcesarchivosoffline20194101554892010218canalsurconlaculturasvg background-position96 983
background-image urlresourcesarchivosoffline20194101554892010218canalsurconlaculturasvg background-position963
caja estilo 20183
padding-top 10px 20183
inline-flex justify-content flex-start3
minifondoslideshowinfo width 250px3
display inline-flex justify-content3
cajamenusecciontv width 1003
100 cajamenusecciontv width3
width 100 cajamenusecciontv3
cajacabecerasecciontv width 1003
0px padding-top 0px3
classappcontenidonoticia rowapptextonoticia h23
appbloquemarcoestructura8p classappcontenidonoticia rowapptextonoticia3
250px important height3
background-color transparent background-size3
10px 2018 fondo3
no-repeat background-color transparent3
background-color fff width3
rounded color fff3
fondo 2018 fondo3
important galeria1381003 minislideshow3
background-colorfff important galeria13810033
color 000 galeria3
10px border1px solid3
padding-top 10px border1px3
display none estilo15159423
open sans105
font-family open105
sans sans-serif97
padding-left 15px91
15px height85
-------media screen83
screen responsive------81
sans-serif font-weight79
margin-left 1px69
margin-right 1px69
1px margin-right69
img width68
important height64
minislideshow minifondoslideshowinfo62
text-decoration none62
width 10061
minislideshow img60
minifondoslideshowinfo width58
text-decoration underline57
color fff57
responsive------ -------media57
none enlaces56
color 00953952
padding-top 10px50
font-size 14px45
font-weight 60044
important background-colortransparent43
twitter facebook41
2px solid40
whatsapp correo40
facebook whatsapp40
close twitter40
compartir close40
padding-right 10px39
1px padding-top39
font-weight 10038
009539 text-decoration37
background-colortransparent color00037
100 font-size37
minislideshow background-colortransparentimportant36
1px solid33
color000 galeria33
border-bottom 2px33
width 300px31
caja estilo31
100 display31
canal sur30
padding-left 10px30
font-size 12px30
color 00030
600 font-size30
font-weight 40030
solid 31313130
background-color f1f3f429
enlaces no28
no visitados28
el usuario28
enlaces visitados28
height 170px28
usuario esta28
esta sobre28
sobre el28
el enlace28
enlaces activos28
170px important28
313131 padding-left28
margin-bottom 20px28
text-transform uppercase27
10px background-color27
color f1f3f427
background-repeat no-repeat27
1px margin-bottom27
20px padding-top27
0px important26
height 0px26
padding-bottom 5px26
15px padding-bottom25
10px padding-right25
display block25
padding-left 0px25
300px important25
padding-top 15px25
underline enlaces25
underline el25
media screen24
999 text-decoration24
color 99924
width auto24
responsive------ media24
font-weight 70024
border-right 1px24
0px solid24
400 font-size23
fondo blanco23
max-width 768px22
fondo gris22
color fffimportant22
text-transform none22
fff text-decoration22
padding-bottom 0px22
height 80px21
important background-colortransparentimportant21
font-size 30px21
2018 fondo21
80px important21
220px important20
margenes y20
background-color transparent20
y estilos20
display flex20
175px important19
background-colortransparentimportant color00019
estilo 202019
display none19
clickfunction cajaredesincollapsehide18
5px 5px18
width 205px18
768 eventstoppropagation18
clickfunctionevent var18
var w18
0 if18
205px important18
windowinnerwidth 018
w 76818
cajaredesincollapsehide cajaredes18
if w18
2020 fondo18
document clickfunction18
w mathmaxdocumentdocumentelementclientwidth18
mathmaxdocumentdocumentelementclientwidth windowinnerwidth18
sliderminifondo padding-left18
margin-top 00px18
cajaredes clickfunctionevent18
2px font-size18
margin-right 2px18
background-colortransparentimportant height17
700 font-size17
display inline-flex17
padding 5px17
height 40px17
250px important16
40px important16
0px margin-bottom16
align-items flex-end16
margin-top 5px16
jcider-nav jcider-nav-left16
estilos caja16
text-align right16
height 175px15
padding-top 5px15
0px margin-top15
jcider-nav-right display15
margenes caja15
jcider-nav-left display15
jcider-nav jcider-nav-right15
margin-top 0px15
line-height 16px14
inline-flex margin-top14
auto height14
display grid14
14px line-height14
fff line-height14
font-size 16px14
178px important14
width 220px14
5px width14
777 text-decoration13
width 4513
16px text-align13
elecciones generales13
14px color13
line-height 19px13
color 77713
width 6513
no-repeat background-color13
fffimportant line-height13
2019 elecciones13
border-right 0px13
sans-serif font-size13
200px important13
14px text-transform13
solid 52905a13
65 display13
font-size 26px12
0px padding-right12
justify-contentflex-end align-items12
padding-top 0px12
flex justify-contentflex-end12
height 250px12
height 178px12
background-color fff12
font-size 50px12
justify-content flex-start12
margin-bottom 10px12
0px 0px11
appmarcotam2 h211
solid fff11
appbloquemarconivel2 appmarcotam211
0 011
font-size 20px11
galeria informativos11
generales 28a11
block left11
right text-transform11
grid margin-top11
padding-bottom 30px11
right 0px11
width 240px11
240px important11
30px border-bottom11
block right11
important galeria168617910
titulodestacadoinformativos font-family10
margin-bottom 0px10
solid 00953910
sur produce10
5px text-transform10
30px padding-bottom10
5px 010
padding 010
0 7px10
appmarcotam4 h210
border-bottom 0px10
margin-bottom 5px10
padding 0px10
12px -------media10
cajacabeceraseccion width10
contenedorcab width10
100 justify-content9
0px border-bottom9
transparent font-family9
appmarcotam8 h29
gris color9
galeria1686180 minislideshow9
line-height 30px9
estilo 2209
galeria1686179 minislideshow9
important galeria16861809
carta noticias9
15px margin-top9
left 15px9
line-height 24px9
position relative9
28a fondo9
120pximportant border9
width 120pximportant9
galeria1686178 minislideshow9
important galeria16861789
padding-bottom 10px9
20px font-weight9
background-color black9
width 120px9
120px important9
fff padding-left9
font-size18px colorfff8
18 108
colorfff margin-right8
width 200px8
appmarcotam3 h28
fondo 20188
important font-weight8
noticias provinciales8
100 background-repeat8
mrgenes 20188
appcintillonoticia font-family8
52905a 20198
0 2px8
height auto8
2px 1px8
line-height 20px8
1px color8
contenedorcabtv width8
260px important7
0px padding-bottom7
50px padding-bottom7
border-bottom 1px7
000 padding-top7
galeria andalucia7
background-color 0007
margin-top 20px7
f1f3f4 margin-left7
color 3131317
background-colortransparent height7
solid 1px7
16px color7
700 color7
f1f3f4 border-bottom7
margin-top 15px7
0px padding-top7
30px color7
minifondoslideshowinfo background-colortransparent7
color 000important7
solid 009539important7
height 260px7
el tiempo6
color dcdcdc6
html html6
cajacabecerasecciontv width6
10px padding-bottom6
andaluca directo6
cajamenusecciontv width6
galeria1639935 minislideshow6
tarde aqu6
solid 3f8bcd6
f1f3f4 background-size6
aqu y6
195px important6
height 195px6
sur con6
important galeria16399356
flex-start align-items6
height 220px6
text-align left6
5px padding-bottom6
none border-bottom6
230px important6
150px important6
border-top 2px6
20px padding6
height 230px6
height 30px6
appantetitulonoticia font-family6
000 line-height6
left 0px6
galeria1686179 jcider-nav6
font-size 21px6
enlace acabeceraseccionactive6
galeria1686178 jcider-nav6
background-size cover6
font-size 24px6
15px margin-bottom6
galeria1686180 jcider-nav6
000 solid6
border 0006
acabeceraseccionactive color6
height 200px6
media only5
galeria carnaval5
divplayerprogramaelshowdebertin width5
carnaval 20205
todos los5
only screen5
flex-start cabeceraseccion5
aseccion text-transform5
bottom background-repeat5
5px background-color5
cabeceraseccion font-weight5
galeria elecciones5
cajamenuseccion margin-top5
100 cajamenuseccion5
imagenes color5
divdescripciontextoelshowdebertin font-size5
12px aseccion5
elecciones 26m5
color e630275
border-radius 5px5
0px width5
menuseccion font-weight5
width 250px5
0px cajacabeceraseccion5
televisin radio5
color313131 margin-right5
menuseccionmedio border-right5
24px padding-top5
acabeceraseccionvisited color5
h2 font-family5
estilo1492221 appbloquemarconivel25
none color5
visitados acabeceraseccionhover5
acabeceraseccionhover color5
d8d8d8 padding5
activos cajamenuseccion5
cajamenuseccion width5
barraprovincias ul5
menuseccioninicio border-right5
10px menuseccionmedio5
10px menuseccionfinal5
appentradilla font-family5
menuseccionfinal border-right5
10px aseccion5
aseccion font-family5
uppercase aaseccionlink5
000 text-decoration5
aaseccionlink color5
visitados aaseccionvisited5
aaseccionvisited color5
visitados aaseccionhover5
aaseccionhover color5
enlace aaseccionactive5
aaseccionactive color5
activos menuseccioninicio5
font-size18px color3131315
26px font-weight5
solid d8d8d85
10px cajacabeceraseccion5
no diarios5
appmarcotam5 h25
width 200pximportant5
visitados acabeceraseccionvisited5
acabeceraseccionlink color5
30px padding5
height 300px5
cabeceraseccion font-family5
45 cabeceraseccion5
filete superior5
sur radio5
5px solid5
appmarcotam6 h25
background-image urlresourcesarchivosoffline20194101554917231136eleccionesgenerales-logo28asvg4
toda costa4
line-height 18px4
top 290px4
10px border-radius4
rtva comunicacin4
padding 10px4
28a color4
portada radio4
gris 28a4
70px margin-left4
background-size 70px4
background-position96 1004
background-image urlresourcesarchivosoffline20194101554909043374papeleta2svg4
y ahora4
el show4
divdescripcionprogramaelshowdebertin width4
margin-top 10px4
produce canal4
19px important4
con el4
flex-end padding-bottom4
appcontenidodestacadoinformativos textodestacadoinformativos4
appbloquemarcoestructura8p appcontenidodestacadoinformativos4
18px padding4
10px padding-top4
313131 padding4
auto width4
important line-height4
auto top4
top 118px4
cabeceras secciones4
appmarcotam1 h24
auto height40px4
appbloquemarconivel2 appmarcotam14
uppercase padding-left4
no-repeat background-size4
background-position right4
5px margin-top4
118px left4
textodestacadoinformativos titulodestacadoinformativos4
2019 fondo4
septiembre 20194
cerca link4
009539important margenes4
fondo negro4
minislideshow background-colortransparent4
underline text-decoration-color4
210px important4
descdestacadoinformativos font-family4
24px color4
009539 padding4
uppercase menuseccion4
ul li4
line-height 32px4
5px 7px4
600 color4
009539 estilo14922214
2020 semifinal4
no-repeat important4
5px no-repeat4
1px 5px4
urlresourcesarchivosoffline20187251532521440369recurso8svg 1px4
height 210px4
768px contenedorcab4
galeria1639935 jcider-nav4
270px important4
220 fondo4
background-colortransparent colorfff4
gris f1f3f44
border-bottom 5px4
pie verde4
height 270px4
009539 margenes4
width 150px4
5px acabeceraseccionlink4
pie inferior4
flex-end menuseccioninicio4
f1f3f4 border-top4
f1f3f4 filete4
fff estilo13017734
divtituloprogramaelshowdebertin width4
los programas4
background urlresourcesarchivosoffline20187251532521440369recurso8svg4
padding-top 20px4
px color4
width 175px4
15px padding-right4
color 009539important4
cultura fondo4
background-colorfff important4
transparent color4
galeria1639938 jcider-nav4
padding-bottom 15px4
background-position bottom4
correo andaluca4
dcdcdc text-decoration4
widget programacion4
0px aseccioncabalacarta4
sans font-weight4
1 px4
400 line-height4
filete 14
recuadro filete4
10px 20184
21px padding-bottom4
background-position90 1004
cajacabalacarta width4
10px margenes4
contenedorcabalacarta width4
margin-left auto3
20px margin-bottom3
margin-right auto3
relative top3
important galeria17034593
galeria1639938 minislideshow3
divcontainerespecialtvelshowdebertin margin-top3
margin-top auto3
768px contenedorcabtv3
galeria1703459 minislideshow3
important galeria17035443
galeria1703544 minislideshow3
auto margin-bottom3
background-colortransparentimportant galeria1686179slidermini3
background-size contain3
galeria1686180slidermini background-colortransparentimportant3
0px color3
estilo1686351 padding-top3
f1f3f4 estilo16863513
768px mrgenes3
00px -------media3
00px galeria16861803
background-colortransparentimportant galeria1686180slidermini3
estilo1686351 appbloquemarcoestructura8p3
1px galeria16861803
galeria1686180 sliderminifondo3
galeria1686180slider padding-left3
flamenco galeria1686180slider3
1686180 flamenco3
galeria 16861803
fffimportant estilo16863513
padding-right 0px3
00px galeria16861793
border-radius 03
000 padding3
padding-left 20px3
no-repeat background-position3
align-content flex-start3
flex align-content3
rtva direccin3
border-radius 025rem3
var schedule3
septiembre noticias3
colore63027 margin-right3
font-size18px colore630273
pre forvar3
offset pre3
tag httpswww3smartadservercomacsiteid396542fmtid98591ab1tgtoc1outvast4ps1pb3visitsvcnsvphplayer-heightvpwplayer-widthvpmt1tmstptimestampgdpr1gdprconsentgdprconsentpgid3
schedule tag3
00px galeria3
galeria1686179slidermini background-colortransparentimportant3
canal fiesta3
galeria1686178slider padding-left3
galeria1686178slidermini background-colortransparentimportant3
background-colortransparentimportant galeria1686178slidermini3
1px galeria16861783
dcdcdc solid3
border dcdcdc3
galeria1686178 sliderminifondo3
carta galeria1686178slider3
color777 galeria16861783
1686178 radio3
galeria 16861783
font-weight300 font-size3
sans-serif font-weight3003
top 503
solid e630273
background-colortransparent color7773
00px galeria16861783
galeria1686179 sliderminifondo3
7px estilo16863513
galeria1686179slider padding-left3
podcasts galeria1686179slider3
1686179 podcasts3
galeria 16861793
fffimportant galeria3
estilo1686351 appmarcotam43
estilo1686351 titulodestacadoinformativos3
00px fondo3
15px estilo16863513
1px background-color3
cover margin-left3
background-image urlresourcesarchivosoffline20212281614532411695trama-triangulos-2000x3000jpg3
estilo1686351 background-image3
podcasts estilo16863513
fondo podcasts3
important galeria16399383
galeria1514036 minislideshow3
none galeria3
solid 0003
diarios color3
informativos no3
fondo informativos3
blanco pie3
inferior verde3
f1f3f4 pie3
estilo1301773 appbloquemarconivel23
galeria1301919 minislideshow3
estilo1301773 margin-left3
fff estilo14922213
7px padding-bottom3
initial border-bottom3
text-transform initial3
32px padding-top3
5px estilo14922213
carta color3
minislideshow background-color000important3
12px menuseccionfinalblancotv3
lo mas3
galeria1499987 minislideshow3
important galeria14999873
semana santa3
solid fb7f00important3
transparent margin-left3
mas viral3
200px margin-left3
background-color000important height3
background-size 200px3
98 background-repeat3
background-position96 983
urlresourcesarchivosoffline20194101554892010218canalsurconlaculturasvg background-position963
background-image urlresourcesarchivosoffline20194101554892010218canalsurconlaculturasvg3
color000 margenes3
colorfff galeria3
estilo1492221 appcintillonoticia3
activos menuseccioninicioblancotv3
galeria1500046 minislideshow3
flex-end cabecerasecciontv3
visitados acabecerasecciontvhover3
acabecerasecciontvvisited color3
visitados acabecerasecciontvvisited3
acabecerasecciontvlink color3
50px acabecerasecciontvlink3
cabecerasecciontv font-family3
flex align-items3
enlace acabecerasecciontvactive3
45 display3
black cajacabecerasecciontv3
5px margin-bottom3
height 50px3
noticias deportes3
secciones noticias3
cine canal3
acabecerasecciontvhover color3
acabecerasecciontvactive color3
aasecciontvactive color3
uppercase aasecciontvlink3
enlace aasecciontvactive3
aasecciontvhover color3
visitados aasecciontvhover3
aasecciontvvisited color3
visitados aasecciontvvisited3
aasecciontvlink color3
asecciontv font-family3
activos cajamenusecciontv3
10px asecciontv3
menuseccionfinalblancotv border-right3
10px menuseccionfinalblancotv3
menuseccionmedioblancotv border-right3
10px menuseccionmedioblancotv3
menuseccioninicioblancotv border-right3
10px menuseccioninicioblancotv3
important galeria15000463
important galeria15000523
blanco filete3
cabecerasecciontv font-weight3
none menuseccioninicioblancotv3
asecciontv text-transform3
12px asecciontv3
menusecciontv font-weight3
uppercase menusecciontv3
30px text-transform3
0px cabecerasecciontv3
margin-right 0px3
inherit margin-top3
align-items inherit3
inline-flex justify-content3
100 cajamenusecciontv3
rowapptextonoticia h23
classappcontenidonoticia rowapptextonoticia3
appbloquemarcoestructura8p classappcontenidonoticia3
400 color3
margin-left 0px3
transparent background-size3
este viernes3
3f8bcd border-bottom3
inferior azul3
e inferior3
superior e3
2020 informativos3
correo document3
text-decoration-color 0095393
0px margin-right3
eventstoppropagation contenedorcab3
iniciogethours minini3
600 padding-right3
canal andaluca3
con andaluca3
compromiso con3
rsc compromiso3
important galeria14462653
fff width3
galeria1500052 minislideshow3
documentales andaluca3
galeria1550543 minislideshow3
galeria1653933 minislideshow3
galeria1653897 minislideshow3
galeria1554917 minislideshow3
galeria1540801 minislideshow3
galeria1540800 minislideshow3
galeria1540799 minislideshow3
galeria1550545 minislideshow3
galeria1540798 minislideshow3
galeria1540329 minislideshow3
galeria1540803 minislideshow3
galeria1538189 minislideshow3
galeria1535753 minislideshow3
galeria1527524 minislideshow3
andaluca el3
galeria1550544 minislideshow3
galeria1550546 minislideshow3
rounded color3
solid dcdcdc3
galeria1418171 minislideshow3
galeria1415541 minislideshow3
galeria1417289 minislideshow3
galeria1562378 minislideshow3
galeria1381003 minislideshow3
important galeria13810033
000 galeria3
border1px solid3
galeria1550547 minislideshow3
10px border1px3
estilo 20183
fondo f1f3f43
fff cajatxtandaluciadecercaprovinciales3
6px padding-left3
padding-top 6px3
galeria1554175 minislideshow3
none estilo15159423
important310
color264
width259
height218
1px193
0px191
font-size169
minislideshow166
10px157
padding-left154
15px139
font-weight139
5px124
text-decoration119
screen115
solid114
padding-top111
0108
none107
background-colortransparent106
font-family105
open105
sans105
el102
display99
margin-right99
sans-serif97
enlaces84
background-color83
-------media83
responsive------81
fff80
fondo80
margin-left80
galeria78
margin-top77
background-colortransparentimportant76
padding-bottom76
line-height73
margin-bottom70
minifondoslideshowinfo69
img68
2px68
20px68
00953966
y66
f1f3f466
color00060
159
underline57
h256
visitados56
border-bottom54
30px52
text-transform52
var50
auto47
00047
padding47
14px46
padding-right44
244
twitter41
facebook41
whatsapp40
close40
compartir40
correo40
300px38
canal38
margenes38
337
no37
border-right37
estilo36
w36
andaluca36
435
carta34
caja34
533
right32
jcider-nav31
sur31
con31
no-repeat31
630
enlace30
12px30
media29
noticias29
los29
activos28
esta28
usuario28
sobre28
170px28
16px28
uppercase27
blanco27
background-image27
background-repeat27
radio27
septiembre26
block25
725
gris25
transparent25
max-width24
40px24
left24
824
background-size24
768px24
elecciones23
estilos23
80px22
align-items22
fffimportant22
directo22
if22
text-align22
estilo149222121
flex21
921
200px20
del20
220px20
00px20
appbloquemarconivel219
document19
175px19
informativos19
50px19
html18
1018
205px18
eventstoppropagation18
galeria168617818
sliderminifondo18
clickfunction18
galeria168618018
1118
windowinnerwidth18
mathmaxdocumentdocumentelementclientwidth18
galeria168617918
font-size18px18
clickfunctionevent18
cajaredes18
cajaredesincollapsehide18
inline-flex17
250px17
28a17
7px16
un16
que16
flex-end16
top16
jcider-nav-left16
para16
rtva15
jcider-nav-right15
24px15
estilo168635115
flex-start15
26px15
grid14
178px14
estilo130177314
pie14
border14
1213
1313
19px13
border-radius13
52905a13
justify-content13
generales13
provinciales13
andalucia13
1413
colorfff13
dcdcdc12
galeria163993512
background-position12
justify-contentflex-end12
function11
titulodestacadoinformativos11
240px11
appmarcotam211
filete11
estilo151662011
margin11
las11
1511
009539important11
podcasts10
menuseccioninicio10
cajamenuseccion10
cerca10
televisin10
cajacabeceraseccion10
appmarcotam410
1610
deportes10
se10
cabeceraseccion10
contenedorcab10
aseccion10
produce10
1710
120pximportant9
189
120px9
black9
flamenco9
menuseccioninicioblancotv9
e630279
programas9
appbloquemarcoestructura8p9
appmarcotam89
sevilla9
relative9
position9
este9
verde9
por9
inferior9
lanzadordirectoradio9
199
appcintillonoticia8
mrgenes8
secciones8
ha8
contenedorcabtv8
208
appmarcotam38
contenedormenumovil8
galeria16399388
menuseccionfinalblancotv8
tarde8
todos7
card-header7
260px7
minini7
26m7
documentales7
viernes7
masprogramas7
estilo15159427
superior7
000important7
negro7
border-top7
background-position967
appentradilla7
aqu7
portada7
ul7
background7
estilo14930857
appmarcotam67
escuchar6
widget6
barraprovincias6
70px6
asecciontv6
px6
cabalacarta6
menuseccioncabalacartafinal6
appantetitulonoticia6
cultura6
18px6
center6
cajamenusecciontv6
3f8bcd6
21px6
divtituloprogramaelshowdebertin6
galeria17035446
galeria17034596
ahora6
divdescripcionprogramaelshowdebertin6
divdescripciontextoelshowdebertin6
programacin6
comunicacin6
cover6
mlaga6
acabeceraseccionactive6
cajacabecerasecciontv6
cabecerasecciontv6
urlp6
li6
195px6
150px6
background-color000important6
tiempo6
230px6
urlpubli6
-4px6
aaseccionvisited5
rsc5
toda5
costa5
aaseccionlink5
menuseccionfinal5
id5
especial5
menuseccionmedio5
appmarcotam55
divplayerprogramaelshowdebertin5
es5
bottom5
acabeceraseccionlink5
seis5
acabeceraseccionvisited5
programacion5
210px5
huelva5
granada5
45px5
noticia5
d8d8d85
lo5
nueva5
tierra5
divcontainerespecialtvelshowdebertin5
minfin5
azul5
carnaval5
200pximportant5
only5
andaluciacutea5
max-device-width5
imagenes5
acabeceraseccionhover5
al5
color7775
menuseccion5
cajatxtandaluciadecercaprovinciales5
aaseccionhover5
aaseccionactive5
diarios5
color3131315
galeria15000464
television4
show4
text-decoration-color4
navidad4
mas4
estilo15045304
galeria15000524
now4
ni4
crdoba4
290px4
despierta4
titulovideoultimo4
tituloprograma4
ms4
musica4
118px4
estaacuten4
galeria14999874
min-device-width4
galeria14932264
100px4
una4
jan4
sin4
maacutes4
millones4
su4
moreno4
cine4
appmarcotam14
6px4
cabeceras4
livalcodigo4
270px4
new4
compromiso4
horas4
menuseccioncabalacarta4
214
urlresourcesarchivosoffline20194101554917231136eleccionesgenerales-logo28asvg4
aos4
urlresourcesarchivosoffline20194101554909043374papeleta2svg4
papeleta4
urlresourcesarchivosoffline20187251532521440369recurso8svg4
224
contenedorcabalacarta4
cajacabalacarta4
tv4
link4
background-colorfff4
32px4
aseccioncabalacarta4
recuadro4
audio4
descdestacadoinformativos4
url4
3px4
234
semifinal4
relacionada4
titular4
cmetelo4
appcontenidodestacadoinformativos4
textodestacadoinformativos4
btnactivefocus4
height40px4
inherit4
mundo4
background-position904
direccin4
eurocopa4
salud4
font-weight3003
offset3
22px3
contain3
8px3
general3
dinamico3
cabpodcasts3
menuseccionfinaltop50cfiesta3
menuseccioncabpodcastsfinal3
menuseccioniniciotop50cfiesta3
forvar3
-6px3
piecomunicacion3
galeria1686178slider3
urlpublivideo3
fechavideo3
schedule3
bertn3
s3
tag3
httpswww3smartadservercomacsiteid396542fmtid98591ab1tgtoc1outvast4ps1pb3visitsvcnsvphplayer-heightvpwplayer-widthvpmt1tmstptimestampgdpr1gdprconsentgdprconsentpgid3
menuseccionmediotop50cfiesta3
galeria1686178slidermini3
243
253
galeria1686179slidermini3
fiesta3
263
galeria1686180slider3
espaa3
lista3
galeria1686180slidermini3
025rem3
galeria1686179slider3
urlresourcesarchivosoffline20212281614532411695trama-triangulos-2000x3000jpg3
desde3
h3
align-content3
273
ad3
liga3
flamencos3
color0095393
colore630273
noche3
mirador3
pre3
provincia3
banda3
283
galeria15408003
comunicacion3
galeria15408013
galeria15549173
galeria16538973
galeria16539333
galeria15505433
galeria15505443
galeria15505453
galeria15407983
galeria15505463
galeria15505473
galeria15541753
0000003
initial3
border1px3
galeria13810033
atitulonoticia3
galeria15407993
mano3
galeria14172893
galeria15140363
viral3
293
10n3
urlresourcesarchivosoffline20194101554892010218canalsurconlaculturasvg3
fb7f00important3
semana3
santa3
galeria13019193
destacado3
hecho3
nuevas3
galeria15275243
00753b3
galeria15357533
galeria15381893
inicio3
galeria15408033
galeria15403293
galeria15623783
galeria14155413
25px3
fernando3
cdiz3
nivel3
hosteleriacutea3
primera3
como3
vuelve3
vuelta3
transparencia3
tras3
primero3
portal3
acuerdo3
303
pesca3
marruecos3
victoria3
e3
talento3
almera3
key3
entrevista3
aasecciontvlink3
galeria14181713
galeria14183593
rounded3
municipales3
galeria14462653
aasecciontvactive3
aasecciontvhover3
aasecciontvvisited3
classappcontenidonoticia3
iniciogethours3
rowapptextonoticia3
menuseccionmedioblancotv3
0pximportant3
menusecciontv3
acabecerasecciontvactive3
acabecerasecciontvhover3
acabecerasecciontvvisited3
data3
acabecerasecciontvlink3
final3

Who hosts Canalsur.es?

Canalsur.es Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Not Applicable

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
18.1104%
GOOGLE
13.7558%
AS-26496-GO-DADDY-COM-LLC
3.6367%
NAMECHEAP-NET
3.0541%
AMAZON-AES
2.2094%
GoDaddy.com, LLC
2.0363%
UNIFIEDLAYER-AS-1
1.9078%
Fara Negar Pardaz Khuzestan
1.5654%
CONFLUENCE-NETWORK-INC
1.4231%
1&1 Internet AG
1.3177%

HTTP Header Analysis for Canalsur.es

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
X-OneAgent-JS-Injection: true
Cache-Control: public, max-age=120
ETag: "1633039083:dtagent10201200909073022F71r"
Last-Modified: Thu, 30 Sep 2021 21:58:02 GMT
Content-Type: text/html;charset=UTF-8
Content-Language: es-ES
Date: Thu, 30 Sep 2021 23:37:24 GMT
Age: 37
X-Cache: HIT from www.canalsur.es
X-Cache-Lookup: HIT from www.canalsur.es:80
Transfer-Encoding: chunked
Via: 1.1 rtvweb11.canalsur.es (squid/3.5.20)
Proxy-Connection: Keep-Alive
Connection: Keep-Alive

Canalsur.es Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Canalsur.es?


Domain Registration (WhoIs) information for Canalsur.es

Websites with Similar Names

Canal-4.tv
403 Forbidden
Canal-9.com
canal-9.com
Canal-a.com
Reconnect Your Domain | Wix.com
Canal-accelerate.xyz
canal-accelerate.xyz – ??????????.com??????????
Canal-alfa.net
canal-alfa em construção
Canal-ar.com.ar
CanalAR | Homepage
Canal-ayuda.com
Canal Ayuda - Inicio

Recently Updated Websites

Vrk-rauhaarige-kromfohrlaender.de (6 seconds ago.)1820006.com (9 seconds ago.)Ybty1289.com (10 seconds ago.)Aoa2812.vip (11 seconds ago.)Ecomboxmarketing.com (12 seconds ago.)Codegaudi.com (14 seconds ago.)Bbvbet408.com (15 seconds ago.)Localdapp.com (16 seconds ago.)Wwmsoftwarellc.com (16 seconds ago.)Waldprofi.net (16 seconds ago.)Tresshairboutique.com (17 seconds ago.)Zentranet.de (17 seconds ago.)Humanrightsed.com (17 seconds ago.)Pequod.sg (17 seconds ago.)Dreambits.in (17 seconds ago.)Prometeo2000.net (17 seconds ago.)Nedeli.org (17 seconds ago.)Bikinibabesillustrated.com (27 seconds ago.)Renova-plus.com (30 seconds ago.)Hopkinsfund.org (32 seconds ago.)Astrac-ctm.com (33 seconds ago.)Magnificentmoxiebling.com (36 seconds ago.)Jtrentjoneslaw.com (41 seconds ago.)Mbfwindows.com (41 seconds ago.)Sachemalumni.org (41 seconds ago.)Mainzelmama.com (42 seconds ago.)Hanabernika.com (49 seconds ago.)Houseofnashville.com (50 seconds ago.)Pawsomepupdogtraining.com (51 seconds ago.)Americordblood.com (54 seconds ago.)

Recently Searched Keywords

4 dcembre (1 second ago.)info uaic orar (1 second ago.)551 videos bdsm (1 second ago.)2018 nbsp2 2018 (2 seconds ago.)owl2-itemactive element (2 seconds ago.)highquality (2 seconds ago.)col-sm-12 text-center pnlpagerfindpageshow (2 seconds ago.)asbestos tile (3 seconds ago.)laufradsatz (3 seconds ago.)полезни връзки (3 seconds ago.)your start (4 seconds ago.)xfer meaning (4 seconds ago.)verliggande (4 seconds ago.)graphic templates (6 seconds ago.)liverpool fc players (6 seconds ago.)oblongo (6 seconds ago.)sur ce blog (6 seconds ago.)haroldfi4 (6 seconds ago.)zedelgem corona (7 seconds ago.)039knowhow039 (8 seconds ago.)0 3333333flex0 (8 seconds ago.)left 0 margin-left (9 seconds ago.)ul linth-child2 item (9 seconds ago.)动物系列 (9 seconds ago.)καιρός (9 seconds ago.)chemical hazard (11 seconds ago.)designstart (11 seconds ago.)vous le (11 seconds ago.)edv (12 seconds ago.)5g關鍵技術與創新應用 (13 seconds ago.)