Canvas: (her)bekijk je favoriete programma’s: actua, docu en series | VRT NU

Safety: Low trust score
Year Founded: 1998
Global Traffic Rank: 118,806
Estimated Worth: $108,000

Bekijk je favoriete Canvas-programma’s en series gratis met VRT NU via de website of app.



Domain summary

Last updated
2021-03-21
Domain label
canvas
Domain extension
be
Domain registered:
1998-01-01
Domain updated:
2021-03-21
Global Traffic Rank
118,806
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$108,000
Estimated daily income
$180
Estimated monthly income
$5,475

Frequently Asked Questions (FAQ)

Q: When was Canvas.be registered?
A: Canvas.be was registered 23 years, 5 months, 2 weeks, 6 days, 13 hours, 15 minutes, 55 seconds ago on Thursday, January 1, 1998.
Q: When was the WHOIS for Canvas.be last updated?
A: The WHOIS entry was last updated 3 months, 13 hours, 15 minutes, 55 seconds ago on Sunday, March 21, 2021.
Q: What are Canvas.be's nameservers?
A: DNS for Canvas.be is provided by the following nameservers:
  • www.dnsbelgium.be
  • ns-621.awsdns-13.net
  • ns-92.awsdns-11.com
  • ns-1375.awsdns-43.org
  • ns-2011.awsdns-59.co.uk
Q: Who is the registrar for the Canvas.be domain?
A: The domain has been registered at DNS Belgium.
Q: What is the traffic rank for Canvas.be?
A: Canvas.be ranks 118,806 globally on Alexa. Canvas.be has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Canvas.be each day?
A: Canvas.be receives approximately 14,365 visitors and 71,825 page impressions per day.
Q: What IP address does Canvas.be resolve to?
A: Canvas.be resolves to the IPv4 address 52.84.95.101.
Q: In what country are Canvas.be servers located in?
A: Canvas.be has servers located in the United States.
Q: What webserver software does Canvas.be use?
A: Canvas.be is powered by webserver.
Q: Who hosts Canvas.be?
A: Canvas.be is hosted by AMAZON-02 in United States.
Q: How much is Canvas.be worth?
A: Canvas.be has an estimated worth of $108,000. An average daily income of approximately $180, which is roughly $5,475 per month.

Canvas.be Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Canvas.be Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Canvas.be

H1 Headings

1 :
  1. Welkom bij Canvas

H2 Headings

14 :
  1. De dag van Canvas
  2. Internationale topfictie
  3. Als je eens wist: partnergeweld
  4. De beste Canvas-programma's
  5. Internationale topdocu's
  6. Documentairefilms
  7. Elke week een nieuwe film
  8. Actua en duiding
  9. Binnenkort op Canvas: bekijk de trailers
  10. Ontdek ook het beste van onze andere kanalen
  11. Bij Canvas is er altijd iets te ontdekken: van topfictie tot straffe documentaires en scherpe info. Check onze nieuwsbrief voor de beste tips uit ons grootse aanbod.
  12. Hallo
  13. Hallo
  14. Feedback

H3 Headings

91 :
  1. Toni Erdmann
  2. Vranckx
  3. Agent Hamilton
  4. Hostiles
  5. The Truth will out
  6. Fargo
  7. The lawyer
  8. Fargo
  9. Agent Hamilton
  10. The Truth will out
  11. Green Wing
  12. Trust me
  13. Before we die
  14. The Pier
  15. Killing Eve
  16. Line of Duty
  17. My brilliant Friend
  18. Babylon Berlin
  19. Als je eens wist
  20. Als je eens wist
  21. Tyrannosaur
  22. Behind closed doors: through the eyes of a child
  23. Domestic Violence
  24. Domestic Violence
  25. Als je eens wist
  26. Albatros
  27. De Ideale Wereld
  28. Johan Anthierens: niemands Meester, niemands Knecht
  29. De Weekenden
  30. Kinderen van de kolonie
  31. Het Leven.doc
  32. Winteruur
  33. Kutjaar
  34. Revolutie in Indonesië
  35. De Toots Sessies
  36. In Europa
  37. Hi my Name is Jonny Polonsky
  38. Les Enfants de la Collaboration
  39. Team Scheire
  40. De Canvas Popnacht
  41. Unseen: Victims & Survivors of the Cleveland Strangler
  42. A Year of Murder
  43. For Sama
  44. Welcome to Chechnya
  45. Enslaved with Samuel L Jackson
  46. Crime and Punishment
  47. Alicia
  48. The Reagans
  49. Grizzly Man
  50. For Sama
  51. State of Play
  52. Linda and Ali: Two Worlds within four Walls
  53. Alicia
  54. L'île déserte
  55. Behind closed doors: through the eyes of a child
  56. Reset
  57. Welcome to Chechnya
  58. Behind the Redwood Curtain
  59. De Munt, achter het rode Toneelscherm
  60. Dial H-I-S-T-O-R-Y
  61. Panamarenko, the Magic of Art
  62. Grizzly Man
  63. Toni Erdmann
  64. Hostiles
  65. Cairo 678
  66. Tyrannosaur
  67. Da Yie
  68. Pathetiek
  69. Dem Dem!
  70. Retouch
  71. Terzake
  72. De Afspraak
  73. De Afspraak op vrijdag
  74. Vranckx
  75. Vranckx & de Nomaden
  76. Extra Time
  77. Privacy & ik
  78. Wij, Roger Raveel
  79. Boerke
  80. Your Honor
  81. FC United
  82. Charlatan
  83. En toen was het stil
  84. Salah
  85. BDW
  86. Beau Séjour
  87. The bay
  88. Schrijf je in op onze Canvas-nieuwsbrief!
  89. VRT-Profiel
  90. Aanmelden
  91. Registreren

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

89 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

65:

Links - Internal (nofollow)

0:

Links - Outbound

56:

Links - Outbound (nofollow)

0:

Keyword Cloud for Canvas.be

hetpartnergeweldvast bovenaan paginalijst vastdi 9 maart3manvan hetvoor1tussenjaarwereldjevlaamseprivacyhaarkinderenvranckxaflverbergvastfebruari89 minvan weergavevrtprofielcanvas 1bijsluitbovenaanzijnwist1 mindocumentairefilmsdoorbovenaan paginaweergave maakop in eenafl 1wordttwee4aanmeldenduidinghamiltonmin behindverhaaldivan weergave maakweergavemaak lijst vastvan partnergeweldmaak9 maart 0903canvasportretvanreeksbekijkvolledige reekspraatzominhet verhaalhundi 9hulp nodig0903bestehet verhaal vanlevenweergave maak lijsthet levenachterslachtoffersbehindampnaar hetvolledigcanvas zooverje eenskortfilmeens wist9 maartafspraakbij hetregistrerenkanalenals je eenseenmet zijnlijst vast bovenaanvast bovenaanmetomaliciamaart canvas 1aanmelden metkijkcanvas volledig seizoencanvas volledige reeksvrtnodigvolledigelijst vannaarcanvas volledigopdiegezinonzecanvas kortfilmvolledig seizoenpolitiecanvas di 9beste vancanvas zamaart canvasmoet eeneenshet beste vanverhaal vanmaart 09032lijstzahulponderzoektvanafmaak lijstje eens wistalspraat metcanvas volledigecanvas 1 minmaartmoettehet bestezoekendagals jecanvas diseizoen0van eenpaginalijst van weergave

Longtail Keyword Density for Canvas.be

KeywordsOccurences
canvas volledig seizoen10
canvas volledige reeks10
maak lijst vast7
9 maart 09037
di 9 maart7
vast bovenaan pagina7
lijst vast bovenaan7
je eens wist6
canvas di 96
als je eens6
canvas 1 min6
weergave maak lijst4
van weergave maak4
lijst van weergave4
maart canvas 14
op in een3
het verhaal van3
het beste van3
volledige reeks14
volledig seizoen11
canvas volledig10
canvas volledige10
di 97
maart 09037
bovenaan pagina7
vast bovenaan7
lijst vast7
maak lijst7
9 maart7
als je7
canvas di7
eens wist6
canvas 16
je eens6
1 min6
maart canvas4
canvas kortfilm4
canvas zo4
van het4
weergave maak4
van weergave4
lijst van4
afl 14
het leven4
bij het3
het beste3
beste van3
hulp nodig3
naar het3
verhaal van3
het verhaal3
praat met3
van partnergeweld3
min behind3
89 min3
met zijn3
van een3
moet een3
canvas za3
aanmelden met3
canvas91
van52
een46
min31
het30
met19
op18
maart17
je15
reeks15
volledige14
011
volledig11
seizoen11
lijst11
zijn9
naar8
di8
over8
haar7
als7
te7
maak7
vast7
bovenaan7
bij7
pagina7
17
09037
partnergeweld6
wist6
eens6
die6
beste6
vrt6
leven6
aanmelden6
slachtoffers5
man5
registreren5
moet5
afl5
verberg4
alicia4
dag4
documentairefilms4
zo4
hulp4
kortfilm4
weergave4
verhaal4
jaar4
zoeken4
kinderen4
vanaf4
door4
onze4
onderzoekt4
hun4
om4
februari4
gezin3
amp3
portret3
twee3
achter3
voor3
afspraak3
privacy3
nodig3
duiding3
23
vlaamse3
vranckx3
politie3
kanalen3
wordt3
hamilton3
bekijk3
33
za3
wereld3
kijk3
43
tussen3
behind3
sluit3
praat3
vrt-profiel3

Who hosts Canvas.be?

Canvas.be Hosting Provider Information

Hosted IP Address:52.84.95.101
Hosted Hostname:server-52-84-95-101.lhr62.r.cloudfront.net
Service Provider:AMAZON-02
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Not Applicable

Is "AMAZON-02" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
AMAZON-02
0.4796%

HTTP Header Analysis for Canvas.be

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html;charset=utf-8
Content-Length: 15995
Connection: keep-alive
Date: Sun, 21 Mar 2021 04:58:35 GMT
X-Content-Type-Options: nosniff
Expires: Sun, 21 Mar 2021 05:02:45 GMT
Cache-Control: max-age=300
X-UA-Compatible: IE=edge
Content-Encoding: gzip
X-Served-By: i-0632883e90d7e8d22
Accept-Ranges: bytes
Vary: Accept-Encoding
X-Cache: Hit from cloudfront
Via: 1.1 006e53d1925d4d044125ff497c18b3b4.cloudfront.net (CloudFront)
X-Amz-Cf-Pop: LHR62-C4
X-Amz-Cf-Id: vYqcYiDHYnFJO3aMOE8wxXl1ltrSLzsT6ZmkeI-vbgMKZjiVVwpq2Q==
Age: 280

Canvas.be Domain Nameserver Information

HostIP AddressCountry
www.dnsbelgium.be 45.60.74.42
ns-621.awsdns-13.net 205.251.194.109
ns-92.awsdns-11.com 205.251.192.92
ns-1375.awsdns-43.org 205.251.197.95
ns-2011.awsdns-59.co.uk 205.251.199.219


Need to find out who hosts Canvas.be?


Domain Registration (WhoIs) information for Canvas.be

 % .be Whois Server 6.1
%
% The WHOIS service offered by DNS Belgium and the access to the records in the DNS Belgium
% WHOIS database are provided for information purposes only. It allows
% persons to check whether a specific domain name is still available or not
% and to obtain information related to the registration records of
% existing domain names.
%
% DNS Belgium cannot, under any circumstances, be held liable where the stored
% information would prove to be incomplete or inaccurate in any sense.
%
% By submitting a query you agree not to use the information made available
% to:
% - allow, enable or otherwise support the transmission of unsolicited,
% commercial advertising or other solicitations whether via email or otherwise;
% - target advertising in any possible way;
% - to cause nuisance in any possible way to the domain name holders by sending
% messages to them (whether by automated, electronic processes capable of
% enabling high volumes or other possible means).
%
% Without prejudice to the above, it is explicitly forbidden to extract, copy
% and/or use or re-utilise in any form and by any means (electronically or
% not) the whole or a quantitatively or qualitatively substantial part
% of the contents of the WHOIS database without prior and explicit permission
% by DNS Belgium, nor in any attempt thereof, to apply automated, electronic
% processes to DNS Belgium (or its systems).
%
% You agree that any reproduction and/or transmission of data for commercial
% purposes will always be considered as the extraction of a substantial
% part of the content of the WHOIS database.
%
% By submitting the query you agree to abide by this policy and accept that
% DNS Belgium can take measures to limit the use of its whois services in order to
% protect the privacy of its registrants or the integrity of the database.
%

Domain: canvas.be
Status: NOT AVAILABLE
Registered: Thu Jan 1 1998

Registrant:
Not shown, please visit www.dnsbelgium.be for webbased whois.

Registrar Technical Contacts:
Organisation: BELNET
Language: en
Phone: +32.27903333
Fax: +32.27903332

Registrar:
Name: BELNET
Website: https://domains.belnet.be

Nameservers:
ns-621.awsdns-13.net
ns-92.awsdns-11.com
ns-1375.awsdns-43.org
ns-2011.awsdns-59.co.uk

Keys:

Flags:

Please visit www.dnsbelgium.be for more info.

Websites with Similar Names

Canva-deploy.com
canva-deploy.com
Canva-pix.com
Create an Ecommerce Website and Sell Online! Ecommerce Software by Shopify
Canva.art
Attention Required! | Cloudflare
Canva.cam
canva.cam
Canva.co.kr
Attention Required! | Cloudflare
Canva.college
canva.college
Canva.com
Attention Required! | Cloudflare
Canva.com.ph
canva.com.ph
Canva.design
Attention Required! | Cloudflare

Recently Updated Websites

Ibexfunds.com (3 seconds ago.)Buildingdestinyla.com (3 seconds ago.)Scaraggi.com (4 seconds ago.)Cruchmenu.com (4 seconds ago.)Fdrcoin.com (6 seconds ago.)Repo-nord.com (6 seconds ago.)Genuinehealthgroup.com (6 seconds ago.)Appworks.capital (7 seconds ago.)Longhairi.com (8 seconds ago.)Swingpirate.com (8 seconds ago.)Shodoy.com (9 seconds ago.)Qingyuan.net (10 seconds ago.)Chantellcouch.com (11 seconds ago.)Thegoodswpg.com (12 seconds ago.)Bajanativestravel.com (12 seconds ago.)Htk.tech (12 seconds ago.)Mncpropertiesgh.com (13 seconds ago.)Technobros.us (15 seconds ago.)Loretta-gonzalez.com (15 seconds ago.)Ep-nirschl.de (16 seconds ago.)Savemedic.com (16 seconds ago.)Blackcovid.com (18 seconds ago.)Howotruck.vn (18 seconds ago.)Thedigitaltransmission.com (18 seconds ago.)Laraandparker.com (19 seconds ago.)Buyrapidtests.com (19 seconds ago.)Satilikutupaketmalzemesi.com (19 seconds ago.)Alliancerussia.com (19 seconds ago.)Ghostdesignstudio.com (20 seconds ago.)Umortgagesolutions.com (20 seconds ago.)

Recently Searched Keywords

engineering mississippi state (1 second ago.)jfc meaning|what does jfc stand for|full form of jfc (4 seconds ago.)közösségi élet (7 seconds ago.)our 5 best external hard drives in 2020 (9 seconds ago.)surrounds (10 seconds ago.)hagyomanyokhaza (11 seconds ago.)e58356 (12 seconds ago.)stuff we like (13 seconds ago.)safari millenium (14 seconds ago.)contacter notre service presse (15 seconds ago.)above all chords (16 seconds ago.)windows amp stack (16 seconds ago.)compound medication (17 seconds ago.)bureaucracy out of control (20 seconds ago.)us supreme court cases (22 seconds ago.)word for public (23 seconds ago.)15 inch gravel rally tyres (24 seconds ago.)propolis yang (26 seconds ago.)17 nachhaltigkeitsziele (30 seconds ago.)avepoint inc (32 seconds ago.)style-jeiw5mx6label (34 seconds ago.)megaways play (37 seconds ago.)saddle sore (38 seconds ago.)wheelie good (41 seconds ago.)32343 (42 seconds ago.)advan-kt (43 seconds ago.)favorable (43 seconds ago.)press belts (45 seconds ago.)get to know our community members (45 seconds ago.)sud evolution services (46 seconds ago.)