|  Connecting Friends & Family During a Health Event | CaringBridge
Low trust score  | 
CaringBridge is a nonprofit committed to bringing friends and family together during any form of health journey. Start a site today for you or a loved one! Website Information has a Low Trust Score, a Statvoo Rank of C, an Alexa Rank of 19,375, a Majestic Rank of 2,661, a Domain Authority of 82% and is not listed in DMOZ. is hosted by Tiggee LLC in Virginia, Reston, United States, 20191. has an IP Address of and a hostname of

The domain was registered 1 decade 7 years 10 months ago by , it was last modified 201 decades 9 years 1 day ago and currently is set to expire 201 decades 9 years 1 day ago.

Whois information for

Full Whois Lookup for Whois Lookup

Registry Domain ID: D80006806-LROR
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2017-03-02T20:13:52Z
Creation Date: 2001-11-20T05:26:19Z
Registry Expiry Date: 2017-11-20T05:26:19Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited
Registry Registrant ID: C2659271-LROR
Registrant Name: CaringBridge Foundation
Registrant Organization: CaringBridge Foundation
Registrant Street: 1715 YANKEE DOODLE RD STE 301
Registrant Street: Suite 301
Registrant City: Eagan
Registrant State/Province: MN
Registrant Postal Code: 55121-1660
Registrant Country: US
Registrant Phone: +1.6514527940
Registrant Phone Ext:
Registrant Fax: +1.6516817115
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C92437936-LROR
Admin Name: CB Admin
Admin Organization: CaringBridge
Admin Street: 2750 BLUE WATERS RD STE 275
Admin City: Eagan
Admin State/Province: MN
Admin Postal Code: 55121-1679
Admin Country: US
Admin Phone: +1.6514527940
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C92437936-LROR
Tech Name: CB Admin
Tech Organization: CaringBridge
Tech Street: 2750 BLUE WATERS RD STE 275
Tech City: Eagan
Tech State/Province: MN
Tech Postal Code: 55121-1679
Tech Country: US
Tech Phone: +1.6514527940
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: NS-1302.AWSDNS-34.ORG
Name Server: NS-181.AWSDNS-22.COM
Name Server: NS-1645.AWSDNS-13.CO.UK
Name Server: NS-749.AWSDNS-29.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of WHOIS database: 2017-08-18T07:34:00Z

Who hosts Web Server Information

Hosted IP Address:
Service Provider:Tiggee LLC
Hosted Country:United StatesUS
Location Latitude:38.9311
Location Longitude:-77.3489
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 10 Jun 2015 06:14:01 GMT
Server: Apache
Vary: Accept-encoding
X-Powered-By: PHP/5.4.21 ZendServer/6.2.0
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-UA-Compatible: IE=Edge,chrome=1
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

getstart a siteyearsnameour0healthpersonalwebsiteyour personalyouryouusprotectedfriendsdonate to caringbridgestoriesstartjourneyfindhelpsearchsiteweprivatehealth journeycaringbridge20 yearsdonate

Longtail Keyword Density for

start a site3
donate to caringbridge3
health journey5
20 years3
your personal3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States States United States States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?