Personal Health Journals for Any Condition | CaringBridge

Safety: High trust score
Year Founded: 2001
Global Traffic Rank: 5,808
Estimated Worth: $2,782,080

A CaringBridge website is a personal health journal, rallying friends and family during any type of health journey. Start a free CaringBridge website today.



Domain summary

Last updated
2021-09-15
Domain label
caringbridge
Domain extension
org
Domain registered:
2001-11-20
Domain updated:
2021-09-15
Global Traffic Rank
5,808
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$2,782,080
Estimated daily income
$2,576
Estimated monthly income
$78,353

Frequently Asked Questions (FAQ)

Q: When was Caringbridge.org registered?
A: Caringbridge.org was registered 20 years, 5 months, 3 weeks, 5 days, 21 hours, 31 minutes, 53 seconds ago on Tuesday, November 20, 2001.
Q: When was the WHOIS for Caringbridge.org last updated?
A: The WHOIS entry was last updated 8 months, 1 day, 21 hours, 31 minutes, 53 seconds ago on Wednesday, September 15, 2021.
Q: What are Caringbridge.org's nameservers?
A: DNS for Caringbridge.org is provided by the following nameservers:
  • ns-1302.awsdns-34.org
  • ns-1302.awsdns-34.org
  • ns-1302.awsdns-34.org
  • ns-181.awsdns-22.com
  • ns-181.awsdns-22.com
  • ns-181.awsdns-22.com
  • ns-1645.awsdns-13.co.uk
  • ns-1645.awsdns-13.co.uk
  • ns-1645.awsdns-13.co.uk
  • ns-749.awsdns-29.net
  • ns-749.awsdns-29.net
  • ns-749.awsdns-29.net
Q: Who is the registrar for the Caringbridge.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Caringbridge.org?
A: Caringbridge.org ranks 5,808 globally on Alexa. Caringbridge.org has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Caringbridge.org each day?
A: Caringbridge.org receives approximately 321,970 visitors and 2,575,760 page impressions per day.
Q: What IP address does Caringbridge.org resolve to?
A: Caringbridge.org resolves to the IPv4 address 52.84.92.127.
Q: In what country are Caringbridge.org servers located in?
A: Caringbridge.org has servers located in the United States.
Q: What webserver software does Caringbridge.org use?
A: Caringbridge.org is powered by Apache webserver.
Q: Who hosts Caringbridge.org?
A: Caringbridge.org is hosted by AMAZON-02 in United States.
Q: How much is Caringbridge.org worth?
A: Caringbridge.org has an estimated worth of $2,782,080. An average daily income of approximately $2,576, which is roughly $78,353 per month.

Caringbridge.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Caringbridge.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Caringbridge.org

H1 Headings

0 :

H2 Headings

3 :
  1. Start your free, personal CaringBridge site today
  2. Benefits
  3. Keep In Touch

H3 Headings

3 :
  1. Dedicated to Your Health Journey
  2. Private, Protected and Ad-Free
  3. Coordinate Help

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

10 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-729258-1

Links - Internal

30:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Caringbridge.org

your personalread moresiteonehealthupdatesillnesshellip readsupportpersonalnewusallhealth journeyfeelingspersonal caringbridgeyoureaddonateyour childhellipstartourfamilyfindprivacyemailsfriendschildhellip read morelovehaswebsitefreethroughyourjourneycharitydonate to caringbridgefamily and friendssearchcaringbridgemorecanname

Who hosts Caringbridge.org?

Caringbridge.org Hosting Provider Information

Hosted IP Address:52.84.92.127
Hosted Hostname:server-52-84-92-127.lhr62.r.cloudfront.net
Service Provider:AMAZON-02
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Apache

Is "AMAZON-02" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.9161%
GOOGLE
14.0532%
AS-26496-GO-DADDY-COM-LLC
3.4879%
NAMECHEAP-NET
3.1470%
AMAZON-AES
2.2136%
GoDaddy.com, LLC
2.0287%
UNIFIEDLAYER-AS-1
1.9645%
Fara Negar Pardaz Khuzestan
1.6143%
CONFLUENCE-NETWORK-INC
1.4660%
1&1 Internet AG
1.3358%
AMAZON-02
1.3143%

HTTP Header Analysis for Caringbridge.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Date: Wed, 15 Sep 2021 09:54:13 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
X-UA-Compatible: IE=Edge,chrome=1
X-Cache: Miss from cloudfront
Via: 1.1 eff74d3c4669ba49791c396ee58f3713.cloudfront.net (CloudFront)
X-Amz-Cf-Pop: LHR62-C4
X-Amz-Cf-Id: FgMmqOFq9U0FRrX7Iw88aB22I4gs_nlRVPUZM2hitvkt0TUL3blMuQ==

Caringbridge.org Domain Nameserver Information

HostIP AddressCountry
ns-1302.awsdns-34.org 205.251.197.22
ns-1302.awsdns-34.org 205.251.197.22
ns-1302.awsdns-34.org 205.251.197.22
ns-181.awsdns-22.com 205.251.192.181
ns-181.awsdns-22.com 205.251.192.181
ns-181.awsdns-22.com 205.251.192.181
ns-1645.awsdns-13.co.uk 205.251.198.109
ns-1645.awsdns-13.co.uk 205.251.198.109
ns-1645.awsdns-13.co.uk 205.251.198.109
ns-749.awsdns-29.net 205.251.194.237
ns-749.awsdns-29.net 205.251.194.237
ns-749.awsdns-29.net 205.251.194.237


Need to find out who hosts Caringbridge.org?


Domain Registration (WhoIs) information for Caringbridge.org

 Domain Name: CARINGBRIDGE.ORG
Registry Domain ID: D80006806-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2020-09-21T06:13:19Z
Creation Date: 2001-11-20T05:26:19Z
Registry Expiry Date: 2023-11-20T05:26:19Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8777228662
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: CaringBridge Foundation
Registrant State/Province: MN
Registrant Country: US
Name Server: NS-1302.AWSDNS-34.ORG
Name Server: NS-181.AWSDNS-22.COM
Name Server: NS-1645.AWSDNS-13.CO.UK
Name Server: NS-749.AWSDNS-29.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2021-09-15T09:53:14Z

Websites with Similar Names

Carin-grudda.com
Carin Grudda
Carin-hair.work
403 Forbidden
Carin-okonomiyaki.com
花林|愛知県蒲郡市で美味しいお好み焼きをご提供しています
Carin-petty.com
Power Lead System
Carin.be
Home | Carin Haircosmetics
Carin.club
CONTACT - Carin Kilby Clark
Carin.com
CARIN - desarrollos integrales

Recently Updated Websites

Factoriacultural.es (2 minutes 4 seconds ago.)Numanzia.com (7 minutes 42 seconds ago.)Nftcode-it.com (12 minutes 53 seconds ago.)Gurugamer.com (19 minutes 31 seconds ago.)Satta-kingn.in (25 minutes 37 seconds ago.)Z1fm.online (41 minutes 15 seconds ago.)Fesehatk.com (1 hour 14 seconds ago.)Ntinews.com (1 hour 9 minutes ago.)Blumble.com (2 hours 17 minutes ago.)Klamboe.com (3 hours 34 minutes ago.)Boot-upstrongintenselytheproduct.vip (3 hours 41 minutes ago.)Cacheeye.com (4 hours 20 minutes ago.)Sattaking-result.com (5 hours 15 minutes ago.)Sattanom.in (5 hours 18 minutes ago.)Ghostbookwriting.services (5 hours 18 minutes ago.)Satta-king.online (5 hours 20 minutes ago.)Sattaking-number.com (5 hours 21 minutes ago.)Satta-king-king.com (5 hours 24 minutes ago.)Notfcompreviews.com (5 hours 26 minutes ago.)Separatecolonist.com (5 hours 26 minutes ago.)Sattakingy.in (5 hours 26 minutes ago.)Ml.miuqf.xyz (5 hours 27 minutes ago.)Sattakingking.com (5 hours 28 minutes ago.)Sattakingindia.com (5 hours 30 minutes ago.)Www-jointrestoregummies.com (5 hours 37 minutes ago.)Pgjoker4d.com (6 hours 6 minutes ago.)Tenderly.co (6 hours 13 minutes ago.)Projeksiyoncum.com (6 hours 21 minutes ago.)Sattakingg.net (6 hours 47 minutes ago.)Seo-selbst.de (6 hours 58 minutes ago.)

Recently Searched Keywords

free lesbo porn (1 second ago.)partners & platforms (3 seconds ago.)content analysis (3 seconds ago.)abclab product list (4 seconds ago.)bauchstraffung (7 seconds ago.)kořeny yogitea čajů (8 seconds ago.)netzteile test (9 seconds ago.)school record (9 seconds ago.)independently (10 seconds ago.)thumbnailwith-caption p (11 seconds ago.)silberankauf (12 seconds ago.)часы traser h3 (12 seconds ago.)anwalt n (14 seconds ago.)middot published october (14 seconds ago.)mes del (16 seconds ago.)news & lifestyle (16 seconds ago.)wynk music apk (18 seconds ago.)portafogli e porta documenti (19 seconds ago.)japanese massage porn (19 seconds ago.)hamur yapıştırıcılar (23 seconds ago.)pcs & tablets (25 seconds ago.)japanese nurse sex japanese massage sex japanese (25 seconds ago.)thimphu thromde (26 seconds ago.)pre wedding photography (28 seconds ago.)header-top top-nav (29 seconds ago.)identity access management (iam) aws (29 seconds ago.)gallery-item-descriptioncomp-k1t1gkgt (29 seconds ago.)armor one (29 seconds ago.)sicherheitstechnik studium m (31 seconds ago.)multihostingu (31 seconds ago.)