|  Carpenter Diversified Farms - Home Page
Low trust score  | 
Highland Cattle Farm Website Information has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 0, a Majestic Rank of 0, a Domain Authority of 0% and is not listed in DMOZ. is hosted by Weebly, Inc. in United States. has an IP Address of and a hostname of

The domain was registered 6 years 11 months 6 days ago by , it was last modified 3 years 11 months 1 week ago and currently is set to expire 2 years 11 months 1 week ago.

Whois information for

Full Whois Lookup for Whois Lookup

Domain ID: D37603245-US
Sponsoring Registrar: GODADDY.COM, INC.
Sponsoring Registrar IANA ID: 146
Registrar URL (registration services):
Domain Status: clientDeleteProhibited
Domain Status: clientRenewProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Registrant ID: CR125777432
Registrant Name: Kevin Carpenter
Registrant Organization: Carpenter Diversified Farms
Registrant Address1: 13534 Persimmon Trial
Registrant City: Novinger
Registrant State/Province: Missouri
Registrant Postal Code: 63559
Registrant Country: United States
Registrant Country Code: US
Registrant Phone Number: +1.6365441724
Registrant Email: Login to show email
Application Purpose: P1
Registrant Nexus Category: C21
Administrative Contact ID: CR125777434
Administrative Contact Name: Kevin Carpenter
Administrative Contact Organization: Carpenter Diversified Farms
Administrative Contact Address1: 13534 Persimmon Trial
Administrative Contact City: Novinger
Administrative Contact State/Province: Missouri
Administrative Contact Postal Code: 63559
Administrative Contact Country: United States
Administrative Contact Country Code: US
Administrative Contact Phone Number: +1.6365441724
Administrative Contact Email: Login to show email
Application Purpose: P1
Administrative Nexus Category: C21
Billing Contact ID: CR125777435
Billing Contact Name: Kevin Carpenter
Billing Contact Organization: Carpenter Diversified Farms
Billing Contact Address1: 13534 Persimmon Trial
Billing Contact City: Novinger
Billing Contact State/Province: Missouri
Billing Contact Postal Code: 63559
Billing Contact Country: United States
Billing Contact Country Code: US
Billing Contact Phone Number: +1.6365441724
Billing Contact Email: Login to show email
Application Purpose: P1
Billing Nexus Category: C21
Technical Contact ID: CR125777433
Technical Contact Name: Kevin Carpenter
Technical Contact Organization: Carpenter Diversified Farms
Technical Contact Address1: 13534 Persimmon Trial
Technical Contact City: Novinger
Technical Contact State/Province: Missouri
Technical Contact Postal Code: 63559
Technical Contact Country: United States
Technical Contact Country Code: US
Technical Contact Phone Number: +1.6365441724
Technical Contact Email: Login to show email
Application Purpose: P1
Technical Nexus Category: C21
Created by Registrar: GODADDY.COM, INC.
Last Updated by Registrar: GODADDY.COM, INC.
Domain Registration Date: Sun Oct 07 23:24:18 GMT 2012
Domain Expiration Date: Fri Oct 06 23:59:59 GMT 2017
Domain Last Updated Date: Fri Oct 07 00:31:21 GMT 2016
DNSSEC: false

>>>> Whois database was last updated on: Wed Aug 23 12:46:16 GMT 2017

Who hosts Web Server Information

Hosted IP Address:
Service Provider:Weebly, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 17 Jan 2016 00:57:34 GMT
Server: Apache
Cache-Control: private
ETag: W/"0b68d76d17ecba8b7630e349210616a3"
X-UA-Compatible: IE=edge,chrome=1
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

lateinstancedropleave onecharacter creationmyself22if you havecan playcutposted in gamingnbspunless theyexchangeplease leaverenttellif you wantletdiamondsfundslotslevelscommentsalsobuy plexesinto2 hoursdoneanyplayingcompaniondoublelikelyvaluepretty muchmanyhighermilesyou justmore thanlongrequiregamingnbsp noonescarecomments yet pleaseownaccessqueueendtoolsgainakaspeedapparentlytimesbut don8217twould havenowdifferencesupposeeverythingsyou caneventpurchasecreationbankstraining queuedo notyou couldwon8217tpointalthoughputsureteramostbasicscan8217tfairly8211 you canwithingetprettybossesoffcredit cardhousecangotbackeviahave beenknowstill2011 postedneverwinterless thanownedlittlefunpleasetankjoinstartingcan startcan alsorewardsocketsexpensiveaffordyou earn2013 postedbuybullweekenoughexperiencebank savingsandormoney you98traininglowerissuesowninggoldawayholdneedcouldouncesalegamingnbspyearsspend moneymentionedlowearninggamingnbsp no commentsyou wouldminutesvirtuallyhighsomething callednexttimecourse you canpayingthat8217sdosomeonemetal30 years12people28rategoalbuyingdayreasonablyourmay21control1competepricesplayedtakescharactershavefundscraftingtopother thansitestryyou payhelp youjusttop playerevery yearthan11okyou can8217tohrealtime8211 notmy favoritemonthstradeperevenspendmultiplayer dungeonscard10singlealleconomyletstalklastnotshouldif itsafterlevel 20spreadsheetgivewebgreatfew daysremembercomments yet16earlyits justoctseveraltheiringameyourmutual funddoes8211 youmostlyattentionskilllikekevin on junebasicearnedjun 13you think youbitoftenjobthink youbut yourightrealitychineseposted by kevincourseeachgameteamlookcompanionsyou havecomesinceyeah15 minutesrepairsbut nothandyoverwellbeenluckyclassinto the stockperfect worldgame 8211classictranslatelinksomething likebooksplayer youworld bossespiaroundfarming17outmightmecoolinflation rateworthdesignedfreehour27everythingfinancewartunesthem26lotssimplyfriendthereuseworktranslate jun 13guildbiggereitherthey tax youtaxesyou spendraceeveif yourjuneseeyetwhichsimplequicklyyour goingselldungeonssavingssuchgooglemuchno comments yetplexes15missionsbetaincomecreditoncebasicallyseemslotdon8217thourshomemovelesseventshopeplacewell8230cashextrainterestingfirstsomethingyou thinkhomesopenstock marketjumpplayeritemsdo sofamilysetsmaxbeingminingaspectif youcheckpvpmakinggetsclericmy currentgettingrequiredotherarmor setsolopersonalsuspectinvestmentstranslate juncalledsomealwaysbut theytab19earnfact7butnbspleavemaybei8217veuslatershipsmountslivingreal moneypostedcarsyoupaythere is nomoney marketherehoweverwinsits notelfyou reallyneedscourse youusaruncommentsavebelowevemonthoughtdependinghours a daybest32boss6so if youyou dono commentsyet please leavethey taxspendingbankegsoonerholidaybetter thanserversgoyou can playupeasyread33personal financeattacksetpackinflationvsplanbelievesitetakecompetitionratherratesonlinewereavailableso8230seriouslyhelpday skillsoptionsi8217dkey8211 butso ifcostifyesdifferenttheygame playcreatesamequestbaddownyou will findfavoritegood newsbagsgoodlevelexpsmalllevelingprovidechangesometimeslookingthroughso fartop 3learnableyour ownhelpsl55hadjunpostbloglot moreinvestmentyou don8217t2ndlook likecharactersecondstime youpartinitialwartune8211 sokevin8217sleastclickyou mightcan buycasualspecificreallyvs buyrealizemultiplayervariousfoundmakes8211 yourhighlyafter youkevin translatelaunchstartdidmygamescompany25expense0scrollsbeyondbonuscash backsilvermiss8220theperfectyou wantslowerplease leave onecorporationyet pleasehairfarthosemakenewthinkaionitsyou needreadingorderusingmutualbetteryou when youaccountnormalonlyopen betaetcplayerstax24give yousaydevelopers31dayscost youfindcurrentaccountswantworld whichtwomonththoughtsyearneverwinter 8211currentlyconsider13biggestyour notskillspriceyou can buygoingparttimeiskworldpaymentso youthingmorebought2paidnbsp translatewastewelcomeadmitfew minutescheckingi8217myou stillequipmentpointsinvestdozennocombatsupportedyou should29acrosswouldanotherreal timeanyonewithoutbasedturnnicealas30mattersolid514thensellingrealmademake youthatsunderfuturegemsarmorway3bigthings likekevinsavingmainnewsnumbermoneyplay8211 just8211 theysocialearning isk20notelifestuffactuallyduringbecomesuniversalfewprobablyruleveryspecialhavinghardhasdoingspenthalfthey haveonesimilarweeksuntilmarketlogbut itsinsuranceeven iftrack23toogoodiesmutual fundsweusedgovernmentusefulmeansnevernonezendoesn8217ttheseunlesssoaround levelserver4runningtax youagaincredits18gearshowsyou getstockrequirescarhugebetweenversionyou can start

Longtail Keyword Density for

if you want10
yet please leave9
comments yet please9
please leave one9
no comments yet9
posted by kevin9
they tax you6
posted in gamingnbsp6
gamingnbsp no comments5
hours a day4
into the stock3
8211 you can3
so if you3
course you can3
you when you3
you think you3
you can start3
kevin on june3
translate jun 133
there is no3
you will find3
if you have3
you can play3
you can buy3
if you51
you can36
you want14
you get13
you need11
you have11
real money10
do so9
real time9
8211 but9
no comments9
please leave9
yet please9
comments yet9
leave one9
you spend8
but not7
have been7
but they6
tax you6
they tax6
if your6
8211 you6
stock market6
2013 posted6
you might5
cash back5
you don8217t5
perfect world5
course you5
you do5
level 205
things like5
you think5
top 35
gamingnbsp no5
earning isk4
8211 they4
vs buy4
but don8217t4
spend money4
2011 posted4
8211 so4
better than4
you really4
world bosses4
personal finance4
2 hours4
do not4
cost you4
you just4
credit card4
30 years4
you could4
you earn4
few days4
top player4
more than4
you can8217t4
you would4
time you4
but its4
every year3
buy plexes3
day skills3
your not3
8211 your3
less than3
other than3
nbsp translate3
pretty much3
you pay3
bank savings3
would have3
something called3
8211 just3
inflation rate3
mutual funds3
money you3
8211 not3
armor set3
you should3
mutual fund3
player you3
money market3
unless they3
so if3
you still3
so far3
look like3
character creation3
so you3
even if3
my favorite3
can also3
game play3
few minutes3
lot more3
but you3
jun 133
translate jun3
if its3
neverwinter 82113
they have3
multi-player dungeons3
make you3
world which3
my current3
can start3
good news3
help you3
give you3
its not3
after you3
your own3
15 minutes3
training queue3
something like3
open beta3
your going3
can play3
around level3
its just3
can buy3
game 82113
kevin translate3
think you3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?