Home | Carrie Murray Nature Center

Safety: Low trust score
Year Founded: 2009
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-11-04
Category: This site has not been categorized yet

Vist Baltimore City's nature center and park! We are located in the Gwynns Falls Leakin Park, the third largest urban park system in the U.S.


Domain summary

Domain label
carriemurraynaturecenter
Domain extension
org
Domain registered:
2009-10-19
Domain updated:
2020-11-04
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is carriemurraynaturecenter.org ranked relative to other sites:

Percentage of visits to carriemurraynaturecenter.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Carriemurraynaturecenter.org registered?
A: Carriemurraynaturecenter.org was registered 11 years, 2 months, 4 weeks, 2 days, 9 hours, 39 minutes, 11 seconds ago on Monday, October 19, 2009.
Q: When was the WHOIS for Carriemurraynaturecenter.org last updated?
A: The WHOIS entry was last updated 2 months, 2 weeks, 9 hours, 39 minutes, 11 seconds ago on Wednesday, November 4, 2020.
Q: What are Carriemurraynaturecenter.org's nameservers?
A: DNS for Carriemurraynaturecenter.org is provided by the following nameservers:
  • ns7.wixdns.net
  • ns6.wixdns.net
Q: Who is the registrar for the Carriemurraynaturecenter.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Carriemurraynaturecenter.org?
A: Carriemurraynaturecenter.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Carriemurraynaturecenter.org each day?
A: Carriemurraynaturecenter.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Carriemurraynaturecenter.org resolve to?
A: Carriemurraynaturecenter.org resolves to the IPv4 address 23.236.62.147.
Q: In what country are Carriemurraynaturecenter.org servers located in?
A: Carriemurraynaturecenter.org has servers located in the United States.
Q: What webserver software does Carriemurraynaturecenter.org use?
A: Carriemurraynaturecenter.org is powered by Pepyaka/1.19.0 webserver.
Q: Who hosts Carriemurraynaturecenter.org?
A: Carriemurraynaturecenter.org is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Carriemurraynaturecenter.org worth?
A: Carriemurraynaturecenter.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Carriemurraynaturecenter.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Carriemurraynaturecenter.org Free SEO Report

Website Inpage Analysis for Carriemurraynaturecenter.org

H1 Headings

0 :

H2 Headings

4 :
  1. Carrie Murray Nature Center
  2. Welcome!
  3. To view the latest newsletter visit here.
  4. Carrie Murray Nature Center is operated by Baltimore City Recreation and Parks (BCRP).  Thank you, Mayor Young and the Baltimore City Council for supporting BCRP!

H3 Headings

1 :
  1. Nature connection in Gwynns Falls Leakin Park

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

26 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Carriemurraynaturecenter.org

galleryitemtopinfocolor000000custombuttonwrapper96968fgalleryslideshowinfo galleryitemtitlecompjqmjn4cf progalleryinlinestylesfont normal normalgalleryitembottominfonormal normal 56px125em05galleryitemhover7progalleryinlinestyles galleryitemcontainer galleryitembottominfoavenirltw0135light1475496sansserifgalleryitemdescriptioncompjqmjn4cf progalleryinlinestyles galleryitemcontainerselectdatapreviewerror stylek867qevjnavcontainerarrowgalleryitemhoverbeforeitemopacity0768a27nature centernormal normal15px15emoutdoorgalleryitemcontainerprogallerymobileindicator galleryitemtopinfo255 1 stylek867qevjnavcontainerinotprogallerylovedcompjqmjn4cf profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesgalleryitemcontainer galleryitemtopinfoschool fieldavenirltw0135light1475496sansserif color000000normal 22px27px helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecorationchildrenartolcenter baltimoreprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocialgalleryitemdescriptioncompjqmjn4cf progalleryinlinestyles galleryitemcontainerprogallerymobileindicator255 255 importantcompjqmjn4cfgalleryitemhoverdefaultnothidehoverbeforebackground000000importantfontnormal normal normal48px125emnewcompjqmjn4cf progalleryinlinestyles galleryitemcontainer1backgroundcolorrgba25514px143em helveticaw01lighthelveticaw02lightsansserifgalleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryitemhoverimportantcompjqmjn4cf progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorcompjqmjn4cf profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles255 255compjqmjn4cfcenter and parkselectdatapreviewhoveravenirltw0135light1475496sansseriftextdecorationwheelinfoelementcustombuttonwrapper buttoncompjqmjn4cf progalleryinlinestylesenvironmental education04s easepark the thirdbaltimore school fieldbackgroundcolorkidgalleryslideshowinfo galleryitemdescriptioncompjqmjn4cfbaltimore schoolborderstylesolidbordercolorrgba249 249 2490 0fontnormalavenirltw0135light1475496sansserifitemfontcolorslideshow22px27pxnormal normal 15px18pxinotprogallerylovedcompjqmjn4cf profullscreenwrappernormal 15px18pxcompjqmjn4cf progalleryinlinestyles galleryitemcontainerprogallerymobileindicatorstylek867qevjnavcontainerarrow stylek867qevjnavcontainersvgcontainerfullscreenmobilebarcalc100buttonnotprogallerylovednotinfoelementlovedcompjqmjn4cftriplinktargetblanktypewixdatapageidm69x2targetselftypepagelinkpagenameschool field0 importantfontnormal normalbuttoncompjqmjn4cf progalleryinlinestyles galleryitemcontainerbuttonnotprogallerylovednotinfoelementlovedcompjqmjn4cf progalleryinlinestylesyour paymentsolidgalleryitemtextmargin0lineheightnormalletterspacingnormalpark bestborderstylesolidbordercolorrgba249 249progalleryinlinestyles galleryitemcontainer255compjqmjn4cf progalleryinlinestyles000000colorrgb0 0 0varmurray000000colorrgb0bus on fall204 204buttoncompjqmjn4cf profullscreenwrapperhelveticaw01lighthelveticaw02lightsansseriftextdecoration compjqmjn4cf progalleryinlinestylesimportantcompjqmjn4cf progalleryinlinestyleshelveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration compjqmjn4cfpark systemultxtnew olgalleryslideshowinfo svg000000backgroundrgba97 97 94255compjqmjn4cfbaltimore natureprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennavstylek867qevjnavcontainercenterdirection15px18pxbaltimoregalleryitemcontainerprogallerymobileindicator galleryitemwrapper galleryslideshowinfolargest urbannormal 22px27pxyour payment methodimportantleftauto0fontnormalbuttoncompjqmjn4cf progalleryinlinestyles galleryitemcontainerprogallerymobileindicatortxtnewpaymentfallwildfalls parkgalleryitemcontainer galleryitemwrapper galleryitemhoverc7c7c5field trips04s ease 0sffffffcolorrgb255galleryitemdescriptioncompjqmjn4cffullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreennav255 255compjqmjn4cf profullscreenwrapperinfoelementdescriptioncompjqmjn4cffont normalgwynns fallsimportantzindex50255 255helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration compjqmjn4cf progalleryinlinestylesgalleryitemtitlecompjqmjn4cf progalleryinlinestylesbuttoncompjqmjn4cf profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesavenirltw0135light1475496sansserifitemfontcolorslideshow 000000colorrgb0galleryitemhoverdefaultnothidehoverbeforebackground000000 importantcompjqmjn4cfpark leakin parkstylek867qevjnavcontainersvgcontainerstylek867qevjnavcontainerarrowvisitorsbaltimore citys naturebest baltimore15px18px helveticaw01lighthelveticaw02lightsansseriftextdecorationnearinfoelementcustombuttonwrapper980px 0txtnew ul1backgroundcolorrgba255 25515px15em avenirltw0135light1475496sansserifitemdescriptionfontcolorslideshowyou000000backgroundrgba970 0fontnormal normalavenirltw0135light1475496sansserifitemdescriptionfontcolorslideshow 000000colorrgb0avenirltw0135light1475496sansseriftextdecoration compjqmjn4cfcompjqmjn4cf0fontnormal normalstrc1inlinecontent1backgroundcolorrgba255 255 255park gwynns falls15px15em avenirltw0135light1475496sansserifitemdescriptionfontcolorslideshow 000000colorrgb097 94 06galleryitemgalleryitemvideohistorynaturalgalleryitemtitlecompjqmjn4cf progalleryinlinestyles galleryitemcontainer249 249up your paymentselecthovernpark gwynnsb0b0b0left10pxright10pxgalleryitemwrapper galleryslideshowinfothirdmethodhelveticaw01lighthelveticaw02lightsansserif5schoolinotprogallerylovednotinfoelementlovedcompjqmjn4cf progalleryinlinestylestripsgalleryitemcontainer galleryitemwrapper galleryslideshowinfoyour4stylek867qevjrepeaterbuttonlabelprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebartopautobottom0importantfontnormal normalavenirltw0135light1475496sansserifcolorrgb0 0 0fontnormalcitys000000colorrgb0 0infoelementtitleitemfontslideshow normal20compjqmjn4cfcitys nature94 06 importantcompjqmjn4cftriplinktargetblanktypewixdatapageidm69x2targetselftypepagelinkpagenameschool1borderradius0normal normal 22px27pxprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemtopinfo255 255compjqmjn4cf progalleryinlinestyles0 0compjqmjn4cf profullscreenwrapperborderwidth2pxprogalleryinlinestyles galleryitemcontainer galleryitemtopinfobuttoncompjqmjn4cf progalleryinlinestylesnormal normal 20px15emnormal normal normaldivprogalleryparentcontainerwemarginleft calc100 980pxparktryprofullscreenwrapperprogramscolor ffffffavenirltw0135light1475496sansserifcolorrgb0infoelementcustombuttonwrapper buttoncompjqmjn4cfimportantcompjqmjn4cf progalleryinlinestyles galleryitemcontainer3gwynns falls leakin255 importantcompjqmjn4cfgalleryitemhoverdefaultforcehoverbeforecompjqmjn4cf progalleryinlinestylesprovide249 249 1backgroundcolorrgba255fontmurray nature center15px18px helveticaw01lighthelveticaw02lightsansseriftextdecoration compjqmjn4cfleakin park gwynnsgwynns falls parkffffffcenterpark leakinborderwidth2px borderstylesolidbordercolorrgba249 249980pxol uloldirrtlnormal 56px125emgalleryslideshowinfocompjqmjn4cf progalleryinlinestylesfield triplinktargetblanktypewixdatapageidm69x2targetselftypepagelinkpagenameschool field000000color000000custombuttonwrapper buttoncompjqmjn4cf progalleryinlinestylesimportant61615eultxtnewinotprogallerylovedcompjqmjn4cfwild havenprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocial14px143emstylek867qevjnavcontainerarrowstylek867qevjnavcontainerrightdirectioncompjqmjn4cf profullscreenwrapperstylek867qevjnavcontainerarrowstylek867qevjnavcontainercenterdirectionopenselectdatapreviewerroravenirltw0135light1475496sansseriftextdecoration compjqmjn4cf progalleryinlinestylesnormal 20px15em avenirltw0135light1475496sansseriftextdecorationgalleryitemcontainerprogallerymobileindicator galleryitembottominfofallsprogalleryinlinestylesgalleryitemhoverdefaultforcehoverbeforecompjqmjn4cfurban park system06fullscreenviewfullscreenbrightprofullscreeninlinestyles94 06hc1bgbest baltimore nature255compjqmjn4cf profullscreenwrapperbuttoncompjqmjn4cf249 1backgroundcolorrgba255 2550sulavenirltw0135light1475496sansseriftextdecoration compjqmjn4cf profullscreenwrapper0 0compjqmjn4cflargest urban park000000backgroundrgba97 97fullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreenmobilebargalleryitemtitlecompjqmjn4cf06 importantcompjqmjn4cfcustombuttonwrapper buttoncompjqmjn4cffullscreensocialavenirltw0135light1475496sansserifitemdescriptionfontcolorslideshow0 0 importantfontnormalbaltimore nature centerpayment methodonlineacompjqmjn4cf profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles22px27px helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecorationoffergetavenirltw0135light1475496sansserifcolorrgb0 0positionfixed importantleftauto importantzindex50255 importantcompjqmjn4cf progalleryinlinestylesfullscreensidebarsocialfieldnormal normal 14px143emwheel neargalleryitemwrappercalc100 980px 0selectdatapreviewfocusbaltimore citys000000progalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryslideshowinfogalleryitemcontainer galleryslideshowinfoease 0s249 1backgroundcolorrgba25520px15em980px 05orianda22px27px helveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecoration compjqmjn4cfnormal 15px15emprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitembottominfonormal normal 15px15emfalls park leakinstylek867qevjnavcontainerrightdirectionwaterprogalleryinlinestyles galleryitemcontainerprogallerymobileindicator galleryitemwrapperacompjqmjn4cfstoreinfoelementtitleitemfontslideshow normal normal6school field tripsifcarrie murray nature0 0 importantcompjqmjn4cfprogalleryinlinestyles galleryitemcontainer galleryslideshowinfostylek867qevjnavcontainerarrowstylek867qevjnavcontainerleftdirectiongalleryitemhover svgurban parkpark best baltimoreprogalleryinlinestyles galleryitemcontainerprogallerymobileindicatorenvironmentalinfoelementtitleitemfontslideshowgalleryitemcontainerbestimportantleftauto importantzindex50checkgalleryitemhoverbeforeitemopacity 000000backgroundrgba97 97baltimore outdoorsvgpositionabsolutetop0right0bottom0left01 stylek867qevjnavcontainerurbanmargin0lineheightnormalletterspacingnormal txtneweasefalls leakinprofullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylescarrie murraygalleryslideshowinfo infoelementtitleitemfontslideshow normal255compjqmjn4cf profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestylesup0fontnormal normal normalprogalleryinlinestyles galleryitemcontainer galleryitemwrappercitygalleryitemdescriptioncompjqmjn4cf progalleryinlinestylesinotprogallerylovednotinfoelementlovedcompjqmjn4cffalls leakin parklittleeducationgalleryitemwrapper galleryslideshowinfo svggalleryitemcontainerprogallerymobileindicator galleryitemwrapperinfoelementtitlecompjqmjn4cfstylek867qevjnavcontainergalleryitemwrapper galleryitemgalleryitemvideo20px15em avenirltw0135light1475496sansseriftextdecoration97 94we are locatednature center baltimorefield triplinktargetblanktypewixdatapageidm69x2targetselftypepagelinkpagenameschoolacompjqmjn4cf profullscreenwrapper20px15em avenirltw0135light1475496sansseriftextdecoration compjqmjn4cfc8e063normal 15px15em avenirltw0135light1475496sansserifitemdescriptionfontcolorslideshowimportantcompjqmjn4cfavenirltw0135light1475496sansserifitemdescriptionfontcolorslideshow 000000colorrgb0 0strc1dataresponsivegalleryitemwrapper galleryitemhovercalc100 980px 05galleryitemcontainer galleryitembottominfopark wecenter baltimore outdoorborderstylesolidbordercolorrgba249normal 48px125emmurray nature0compjqmjn4cf profullscreenwrapper fullscreenviewfullscreenbrightprofullscreeninlinestyles0 importantfontnormalnormal 14px143emffffffcolorrgb255 255 255compjqmjn4cfgalleryitemwrapper galleryitemhover svgborderwidth2px borderstylesolidbordercolorrgba249citys nature centerhelveticaw01boldhelveticaw02boldhelveticaltw10boldsansseriftextdecorationmarginleft calc1000 0ffffffcolorrgb255 255gwynnssystemselectfocusgalleryslideshowinfo galleryitemtitlecompjqmjn4cfleakin park1pleasecalc100 980pxgalleryitemhoverdefaultnothidehoverbeforebackground000000 importantcompjqmjn4cf progalleryinlinestylesfreebusselectdataerrortrueinfoelementdescriptioncompjqmjn4cf progalleryinlinestylesfullscreennavlargestnormal 14px143em helveticaw01lighthelveticaw02lightsansserifhaventhird largest urbanleakingalleryslideshowinfo infoelementtitleitemfontslideshowthird largestnormalmarginlefthelveticaw01lighthelveticaw02lightsansseriftextdecorationobjectnormal normal 48px125emgalleryitemcontainer galleryitemwrappernormal 20px15embackgroundcolor ffffffclickgalleryitemhoverbeforeitemopacity 000000backgroundrgba97locatedpositionfixed importantleftautogalleryitemtitlecompjqmjn4cf progalleryinlinestyles galleryitemcontainerprogallerymobileindicatornature0 importantcompjqmjn4cf progalleryinlinestylesavenirltw0135light1475496sansserifitemfontcolorslideshow 000000colorrgb0 00compjqmjn4cf profullscreenwrapperup yourfullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensidebarsocialpositionfixedcolorstylek5ih33gmbgtransparent06 importantcompjqmjn4cf progalleryinlinestyles56px125emhelveticaw01lighthelveticaw02lightsansseriftextdecoration compjqmjn4cfgalleryitemcontainerprogallerymobileindicator galleryslideshowinfogalleryitemcontainerprogallerymobileindicator04simportantfontnormalfalsestylek867qevjnavcontainerleftdirection255 1normal 15px18px helveticaw01lighthelveticaw02lightsansseriftextdecorationgalleryslideshowinfo galleryitemdescriptioncompjqmjn4cf progalleryinlinestylescarrieinfoelementtitlecompjqmjn4cf progalleryinlinestyles0 importantcompjqmjn4cffullscreenviewfullscreenbrightprofullscreeninlinestyles fullscreensocial255 255 1

Longtail Keyword Density for Carriemurraynaturecenter.org

KeywordsOccurences
normal normal normal33
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper29
pro-galleryinline-styles gallery-item-container gallery-item-wrapper29
margin-left calc100 980px23
calc100 980px 0520
normal normal 20px15em19
importantfontnormal normal normal15
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-item-hover14
gallery-item-container gallery-item-wrapper gallery-item-hover14
falls leakin park13
carrie murray nature13
font normal normal11
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper gallery-slideshow-info10
custom-button-wrapper buttoncomp-jqmjn4cf pro-galleryinline-styles10
gallery-item-container gallery-item-wrapper gallery-slideshow-info10
gwynns falls leakin9
0 importantfontnormal normal9
normal normal 15px18px9
0 0 importantfontnormal9
importantcomp-jqmjn4cf pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator9
murray nature center9
buttoncomp-jqmjn4cf pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator8
97 94 068
buttoncomp-jqmjn4cf pro-galleryinline-styles gallery-item-container8
normal 20px15em avenir-lt-w0135-light1475496sans-seriftext-decoration8
normal normal 15px15em7
comp-jqmjn4cf pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator7
comp-jqmjn4cf pro-galleryinline-styles gallery-item-container7
helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration comp-jqmjn4cf pro-galleryinline-styles7
15px18px helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration comp-jqmjn4cf7
importantcomp-jqmjn4cf pro-galleryinline-styles gallery-item-container7
normal 15px18px helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration7
000000colorrgb0 0 07
normal normal 56px125em6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info6
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info6
info-element-custom-button-wrapper buttoncomp-jqmjn4cf pro-galleryinline-styles6
pro-galleryinline-styles gallery-item-container gallery-slideshow-info6
pro-galleryinline-styles gallery-item-container gallery-item-top-info6
pro-galleryinline-styles gallery-item-container gallery-item-bottom-info6
06 importantcomp-jqmjn4cf pro-galleryinline-styles6
94 06 importantcomp-jqmjn4cf6
255 255 16
gallery-item-descriptioncomp-jqmjn4cf pro-galleryinline-styles gallery-item-container5
gallery-item-titlecomp-jqmjn4cf pro-galleryinline-styles gallery-item-container5
gallery-item-titlecomp-jqmjn4cf pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator5
gallery-item-descriptioncomp-jqmjn4cf pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator5
normal normal 22px27px5
249 249 1background-colorrgba2554
field triplinktargetblanktypewixdatapageidm69x2targetselftypepagelinkpagenameschool field4
20px15em avenir-lt-w0135-light1475496sans-seriftext-decoration comp-jqmjn4cf4
normal normal 48px125em4
0 0 importantcomp-jqmjn4cf4
nature center baltimore4
largest urban park4
urban park system4
gallery-item-wrapper gallery-slideshow-info svg4
third largest urban4
park the third4
we are located4
inotpro-gallery-lovedcomp-jqmjn4cf pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
acomp-jqmjn4cf pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles4
center and park4
citys nature center4
1background-colorrgba255 255 2554
255 1 style-k867qevjnavcontainer4
gallery-item-hoverdefaultnothide-hoverbeforebackground000000 importantcomp-jqmjn4cf pro-galleryinline-styles4
249 1background-colorrgba255 2554
0 importantcomp-jqmjn4cf pro-galleryinline-styles4
gallery-slideshow-info gallery-item-titlecomp-jqmjn4cf pro-galleryinline-styles4
gallery-slideshow-info info-element-title--itemfontslideshow normal4
info-element-title--itemfontslideshow normal normal4
avenir-lt-w0135-light1475496sans-serif--itemfontcolorslideshow 000000colorrgb0 04
normal 22px27px helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration4
22px27px helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration comp-jqmjn4cf4
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration comp-jqmjn4cf pro-galleryinline-styles4
gallery-slideshow-info gallery-item-descriptioncomp-jqmjn4cf pro-galleryinline-styles4
255 255 importantcomp-jqmjn4cf4
255 importantcomp-jqmjn4cf pro-galleryinline-styles4
baltimore citys nature4
border-width2px border-stylesolidborder-colorrgba249 2494
gallery-item-wrapper gallery-item-hover svg4
000000backgroundrgba97 97 944
bus on fall4
border-stylesolidborder-colorrgba249 249 2494
park best baltimore3
normal normal 14px143em3
baltimore nature center3
best baltimore nature3
park leakin park3
falls park leakin3
park gwynns falls3
center baltimore outdoor3
baltimore school field3
school field trips3
up your payment3
leakin park gwynns3
gwynns falls park3
255 255comp-jqmjn4cf pro-fullscreen-wrapper3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social3
15px15em avenir-lt-w0135-light1475496sans-serif--itemdescriptionfontcolorslideshow 000000colorrgb03
avenir-lt-w0135-light1475496sans-seriftext-decoration comp-jqmjn4cf pro-galleryinline-styles3
gallery-item-hoverbefore--itemopacity 000000backgroundrgba97 973
ffffffcolorrgb255 255 255comp-jqmjn4cf3
04s ease 0s3
normal 15px15em avenir-lt-w0135-light1475496sans-serif--itemdescriptionfontcolorslideshow3
positionfixed importantleftauto importantz-index503
calc100 980px 03
normal 14px143em helvetica-w01-lighthelvetica-w02-lightsans-serif3
255 255comp-jqmjn4cf pro-galleryinline-styles3
avenir-lt-w0135-light1475496sans-serif--itemdescriptionfontcolorslideshow 000000colorrgb0 03
255comp-jqmjn4cf pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar3
avenir-lt-w0135-light1475496sans-serifcolorrgb0 0 0fontnormal3
0 0fontnormal normal3
0fontnormal normal normal3
avenir-lt-w0135-light1475496sans-seriftext-decoration comp-jqmjn4cf pro-fullscreen-wrapper3
comp-jqmjn4cf pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
0 0comp-jqmjn4cf pro-fullscreen-wrapper3
0comp-jqmjn4cf pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social3
buttoncomp-jqmjn4cf pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles3
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav3
your payment method3
normal normal97
pro-galleryinline-styles gallery-item-containerpro-gallery-mobile-indicator49
pro-galleryinline-styles gallery-item-container49
pro-fullscreen-wrapper fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles30
gallery-item-containerpro-gallery-mobile-indicator gallery-item-wrapper29
gallery-item-container gallery-item-wrapper29
gallery-item-wrapper gallery-item-hover28
margin-left calc10024
calc100 980px23
0 023
nature center23
importantcomp-jqmjn4cf pro-galleryinline-styles22
gallery-item-wrapper gallery-slideshow-info20
murray nature20
980px 0520
normal 20px15em19
255 25517
leakin park16
buttoncomp-jqmjn4cf pro-galleryinline-styles16
importantfontnormal normal15
comp-jqmjn4cf pro-galleryinline-styles14
falls leakin13
carrie murray13
gwynns falls12
font normal11
custom-button-wrapper buttoncomp-jqmjn4cf10
gallery-item-descriptioncomp-jqmjn4cf pro-galleryinline-styles10
gallery-item-titlecomp-jqmjn4cf pro-galleryinline-styles10
97 9410
normal 15px18px9
0 importantfontnormal9
000000colorrgb0 09
20px15em avenir-lt-w0135-light1475496sans-seriftext-decoration8
94 068
avenir-lt-w0135-light1475496sans-serif color0000007
ffffffcolorrgb255 2557
15px18px helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration7
field trips7
normal 15px15em7
255 255comp-jqmjn4cf7
helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration comp-jqmjn4cf7
margin0line-heightnormalletter-spacingnormal txtnew7
avenir-lt-w0135-light1475496sans-seriftext-decoration comp-jqmjn4cf7
info-element-custom-button-wrapper buttoncomp-jqmjn4cf6
06 importantcomp-jqmjn4cf6
255 16
gallery-item-containerpro-gallery-mobile-indicator gallery-slideshow-info6
gallery-item-container gallery-item-bottom-info6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-top-info6
gallery-item-container gallery-item-top-info6
gallery-item-container gallery-slideshow-info6
normal 56px125em6
gallery-item-containerpro-gallery-mobile-indicator gallery-item-bottom-info6
1 style-k867qevjnavcontainer5
normal 22px27px5
avenir-lt-w0135-light1475496sans-serifcolorrgb0 05
color ffffff5
background-color ffffff5
wild haven5
environmental education5
third largest4
wheel near4
inotpro-gallery-lovedcomp-jqmjn4cf pro-fullscreen-wrapper4
center baltimore4
000000backgroundrgba97 974
park system4
gallery-item-hoverdefaultforce-hoverbeforecomp-jqmjn4cf pro-galleryinline-styles4
gallery-item-hoverdefaultnothide-hoverbeforebackground000000 importantcomp-jqmjn4cf4
largest urban4
urban park4
park we4
info-element-titlecomp-jqmjn4cf pro-galleryinline-styles4
acomp-jqmjn4cf pro-fullscreen-wrapper4
triplinktargetblanktypewixdatapageidm69x2targetselftypepagelinkpagenameschool field4
citys nature4
info-element-descriptioncomp-jqmjn4cf pro-galleryinline-styles4
field triplinktargetblanktypewixdatapageidm69x2targetselftypepagelinkpagenameschool4
baltimore citys4
gallery-slideshow-info info-element-title--itemfontslideshow4
255 importantcomp-jqmjn4cf4
gallery-slideshow-info svg4
249 1background-colorrgba2554
1background-colorrgba255 2554
border-width2px border-stylesolidborder-colorrgba2494
gallery-slideshow-info gallery-item-descriptioncomp-jqmjn4cf4
txtnew ul4
border-stylesolidborder-colorrgba249 2494
normal 48px125em4
gallery-item-wrapper gallery-itemgallery-item-video4
249 2494
gallery-item-hover svg4
buttonnotpro-gallery-lovednotinfo-element-lovedcomp-jqmjn4cf pro-galleryinline-styles4
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration comp-jqmjn4cf4
22px27px helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration4
0 importantcomp-jqmjn4cf4
gallery-slideshow-info gallery-item-titlecomp-jqmjn4cf4
avenir-lt-w0135-light1475496sans-serif--itemfontcolorslideshow 000000colorrgb04
info-element-title--itemfontslideshow normal4
inotpro-gallery-lovednotinfo-element-lovedcomp-jqmjn4cf pro-galleryinline-styles4
baltimore school3
your payment3
ol ul3
ultxtnew ol3
baltimore outdoor3
positionfixed importantleftauto3
school field3
importantleftauto importantz-index503
falls park3
park leakin3
park gwynns3
park best3
best baltimore3
14px143em helvetica-w01-lighthelvetica-w02-lightsans-serif3
normal 14px143em3
up your3
baltimore nature3
buttoncomp-jqmjn4cf pro-fullscreen-wrapper3
204 2043
0 0fontnormal3
gallery-item-hoverbefore--itemopacity 000000backgroundrgba973
avenir-lt-w0135-light1475496sans-serif--itemdescriptionfontcolorslideshow 000000colorrgb03
15px15em avenir-lt-w0135-light1475496sans-serif--itemdescriptionfontcolorslideshow3
255comp-jqmjn4cf pro-galleryinline-styles3
980px 03
ease 0s3
255comp-jqmjn4cf pro-fullscreen-wrapper3
04s ease3
0fontnormal normal3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-social3
comp-jqmjn4cf pro-fullscreen-wrapper3
0 0comp-jqmjn4cf3
0comp-jqmjn4cf pro-fullscreen-wrapper3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-side-bar-social3
selectdata-previewerror style-k867qevjnavcontainerarrow3
style-k867qevjnavcontainerarrow style-k867qevjnavcontainersvgcontainer3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-nav3
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles fullscreen-mobile-bar3
payment method3
normal161
pro-galleryinline-styles111
065
gallery-item-wrapper58
gallery-item-containerpro-gallery-mobile-indicator49
gallery-item-container49
146
nature44
background-color36
color36
park35
pro-fullscreen-wrapper32
gallery-slideshow-info32
fullscreen-viewfullscreen-brightpro-fullscreen-inline-styles30
gallery-item-hover28
margin-left24
your24
center24
calc10024
980px23
importantcomp-jqmjn4cf22
murray21
comp-jqmjn4cf20
0520
buttoncomp-jqmjn4cf19
20px15em19
txtnew18
baltimore17
field17
leakin16
falls16
positionabsolutetop0right0bottom0left016
importantfontnormal15
style-k867qevjnavcontainer13
carrie13
color00000012
gallery-item-top-info12
gallery-item-bottom-info12
gwynns12
style-k867qevjnavcontainerarrow11
svg11
avenir-lt-w0135-light1475496sans-seriftext-decoration11
font11
gallery-item-titlecomp-jqmjn4cf10
ul10
gallery-item-descriptioncomp-jqmjn4cf10
custom-button-wrapper10
210
310
ffffff10
info-element-custom-button-wrapper10
000000colorrgb09
avenir-lt-w0135-light1475496sans-serif9
15px18px9
haven9
068
48
58
var7
education7
helvetica-w01-lighthelvetica-w02-lightsans-seriftext-decoration7
ffffffcolorrgb2557
margin0line-heightnormalletter-spacingnormal7
15px15em7
ol7
255comp-jqmjn4cf7
trips7
programs7
wild7
offer6
art6
56px125em6
66
urban6
style-k867qevjnavcontainerarrowstyle-k867qevjnavcontainerleft-direction6
style-k867qevjnavcontainerarrowstyle-k867qevjnavcontainercenter-direction6
style-k867qevjnavcontainerarrowstyle-k867qevjnavcontainerright-direction6
avenir-lt-w0135-light1475496sans-serifcolorrgb05
school5
environmental5
22px27px5
payment5
you5
divpro-gallery-parent-container5
important5
ultxtnew5
if5
we4
info-element-descriptioncomp-jqmjn4cf4
n4
helvetica-w01-boldhelvetica-w02-boldhelvetica-lt-w10-boldsans-seriftext-decoration4
000000color0000004
solid4
48px125em4
000000backgroundrgba974
gallery-item-hoverdefaultforce-hoverbeforecomp-jqmjn4cf4
gallery-item-hoverdefaultnothide-hoverbeforebackground0000004
0000004
info-element-titlecomp-jqmjn4cf4
74
b0b0b04
located4
gallery-item-text4
visitors4
c7c7c54
768a274
96968f4
system4
inotpro-gallery-lovedcomp-jqmjn4cf4
acomp-jqmjn4cf4
61615e4
largest4
third4
c8e0634
citys4
avenir-lt-w0135-light1475496sans-serif--itemfontcolorslideshow4
info-element-title--itemfontslideshow4
provide4
history4
store4
style-k867qevjrepeaterbuttonlabel4
up4
kid4
orianda4
near4
wheel4
water4
fall4
buttonnotpro-gallery-lovednotinfo-element-lovedcomp-jqmjn4cf4
triplinktargetblanktypewixdatapageidm69x2targetselftypepagelinkpagenameschool4
bus4
children4
gallery-itemgallery-item-video4
1background-colorrgba2554
border-stylesolidborder-colorrgba2494
border-width2px4
inotpro-gallery-lovednotinfo-element-lovedcomp-jqmjn4cf4
natural4
new3
online3
click3
method3
outdoor3
14px143em3
get3
free3
little3
best3
helvetica-w01-lighthelvetica-w02-lightsans-serif3
0s3
importantleftauto3
fullscreen-social3
style-k867qevjnavcontainercenter-direction3
selectfocus3
selectdata-previewfocus3
avenir-lt-w0135-light1475496sans-serif--itemdescriptionfontcolorslideshow3
selectdata-errortrue3
selectdata-previewerror3
style-k867qevjnavcontainerright-direction3
false3
selecthover3
open3
city3
try3
04s3
check3
please3
ease3
selectdata-previewhover3
style-k867qevjnavcontainerleft-direction3
fullscreen-mobile-bar3
style-k5ih33gmbg3
fullscreen-nav3
fullscreen-side-bar-social3
0comp-jqmjn4cf3
0fontnormal3
positionfixed3
importantz-index503
topautobottom03
gallery-item-hoverbefore--itemopacity3
style-k867qevjnavcontainersvgcontainer3
left10pxright10px3
1border-radius03
hc1bg3
transparent3
strc1inlinecontent3
strc1data-responsive3
oldirrtl3
object3

Who hosts Carriemurraynaturecenter.org?

Carriemurraynaturecenter.org Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Pepyaka/1.19.0

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for Carriemurraynaturecenter.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 04 Nov 2020 06:49:45 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
x-wix-request-id: 1604472584.863485580890125769
link:; rel=preconnect; crossorigin,; rel=preconnect; crossorigin,; rel=preconnect;,; rel=preload; as=script;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preconnect; crossorigin;,; rel=preload; as=script ; crossorigin=anonymous
content-language: en
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=euw2
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Vary: Accept-Encoding
X-Seen-By: sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVh56hbLWstshRitRugA3NJc,2d58ifebGbosy5xc FRaloPX4ngKfQM8fEHbwELHijkV0YtTwzT knd11/U5wDZrWIHlCalF7YnfvOr2cMPpyw==,Nlv1KFVtIvAfa3AK9dRsIwapkcf7zHuiTjxyRGrTVqYfbJaKSXYQ/lskq2jK6SGP,2UNV7KOq4oGjA5 PKsX47FpzP2gYKHiZ6gcHv8pKLk8=,qquldgcFrj2n046g4RNSVOgjK1IbQcmp 2yVeKIZh3A=,9n3wTMzaU7zAZzBAj7gVU5jDhJo7KLeuzIUEi0 NPCoEF3/YbzhHEG9ffXM9P3w9BFNjNRTmQgt5BwMmIVG00A==,l7Ey5khejq81S7sxGe5Nk7niizXMLYLG3FHEk7gYMCCTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,w4q8mm9FnmU4emOs6psVXe7s4UlV0A6Xz 7YNnM6qTiTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,Tw2AanFDQ Wwo8Xxk6ZL7vOBx hvh2Cbd7MMNUXzbHEDxSCjoTiaom1kTRYzH23zZRsF7kSYS2huWL bc0A2McPFHDyuIKVfW94E5g0MwnY=,w4q8mm9FnmU4emOs6psVXe7s4UlV0A6Xz 7YNnM6qTiTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,l7Ey5khejq81S7sxGe5Nk35yuczS9Qzk9kiAOvI5NdZNG KuK VIZfbNzHJu0vJu,LlHHrtdZwfqSTe7u8ayFIzCj8iPvk74rzwBLiy9kCG68cRL 1t6epVpEHNiS3aGrFU13kfQono9P1hl0UcNG0A==,w4q8mm9FnmU4emOs6psVXe7s4UlV0A6Xz 7YNnM6qTiTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,l7Ey5khejq81S7sxGe5Nk9iVF35ywit8ouXIY DNttdNG KuK VIZfbNzHJu0vJu,CU5GbgCT5nWPaA3tUS4mLMRVgaaHX10Zu H2e5JNjIW3YmH8XGFhF3HUygRIu5W3yBLl2WKIEZMhZ5rqvJv20w==
cache-control: private,max-age=0,must-revalidate
Server: Pepyaka/1.19.0
Content-Encoding: gzip

Carriemurraynaturecenter.org Domain Nameserver Information

HostIP AddressCountry
ns7.wixdns.net 216.239.34.100
ns6.wixdns.net 216.239.32.100


Need to find out who hosts Carriemurraynaturecenter.org?


Domain Registration (WhoIs) information for Carriemurraynaturecenter.org

 Domain Name: CARRIEMURRAYNATURECENTER.ORG
Registry Domain ID: D157390123-LROR
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucows.com
Updated Date: 2019-10-18T10:45:00Z
Creation Date: 2009-10-19T23:03:45Z
Registry Expiry Date: 2020-10-19T23:03:45Z
Registrar Registration Expiration Date:
Registrar: Tucows Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4165350123
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Contact Privacy Inc. Customer 0152460350
Registrant State/Province: ON
Registrant Country: CA
Name Server: NS6.WIXDNS.NET
Name Server: NS7.WIXDNS.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-09-08T05:03:38Z

Websites with Similar Names

Carri-craft.com
Carri-Craft Catamaran Boat History and Info
Carri-fast.com
Zen Internet | cPanel Holding Page
Carri-foods.com
This site is brand new
Carri.com
CARRI Systems | Constructeur et intégrateur français de solutions Computing
Carri.net
Apache2 Ubuntu Default Page: It works
Carri69.org
CARR, Citizens for Appropriate Rural Roads
Carriaban.com
carriaban.com is registered with Mailchimp

Recently Updated Websites

87921.xyz (9 seconds ago.)Njijtrd.work (42 seconds ago.)Qrnvns.work (46 seconds ago.)Viisqg.work (46 seconds ago.)Pure-keratin.com (46 seconds ago.)Yvyjhup.work (51 seconds ago.)Jonoey.work (52 seconds ago.)Nhsheu.work (55 seconds ago.)Ztswrvl.work (55 seconds ago.)Ozehpku.work (55 seconds ago.)Zkzkkxj.work (55 seconds ago.)Xgbzcbn.work (55 seconds ago.)Zeypql.work (55 seconds ago.)Qjxbfeq.work (56 seconds ago.)Ozbsctp.work (56 seconds ago.)Qnvbcn.work (56 seconds ago.)Pwggnu.work (56 seconds ago.)Zvypay.work (56 seconds ago.)Onyiun.work (1 minute 19 seconds ago.)Wgbklil.work (1 minute 19 seconds ago.)Pgdqko.work (1 minute 24 seconds ago.)Ppbfqr.work (1 minute 25 seconds ago.)Qchkja.work (1 minute 27 seconds ago.)Qxppxa.work (1 minute 28 seconds ago.)Ybgvst.work (1 minute 28 seconds ago.)Pcvwfu.work (1 minute 28 seconds ago.)Pfymqp.work (1 minute 28 seconds ago.)Dfvbqnh.work (1 minute 28 seconds ago.)Xrvcku.work (1 minute 28 seconds ago.)Zetrnir.work (1 minute 28 seconds ago.)

Recently Searched Keywords

carbon fit (1 second ago.)neue woertlichkeit (2 seconds ago.)galaxy j5 (4 seconds ago.)月经不调 (7 seconds ago.)earth moving services (8 seconds ago.)astrid vikings (9 seconds ago.)klf (10 seconds ago.)divxplanet (11 seconds ago.)multi-buy savings (12 seconds ago.)iphone 7 plus kılıf (13 seconds ago.)mixing and mastering (14 seconds ago.)modo de vida - mayo 2013 (14 seconds ago.)cyber liability (15 seconds ago.)galaxy s6 (19 seconds ago.)make dgpr requests (20 seconds ago.)0px 1px 12px (20 seconds ago.)vrs design (22 seconds ago.)itemspushitem create (23 seconds ago.)[27] çelik spiral boru bağlantı rakorları ve aks. (23 seconds ago.)async charset utf-8 (24 seconds ago.)lyrical lemonade (26 seconds ago.)galaxy note 8 (26 seconds ago.)sauver les abeilles (27 seconds ago.)bzios regio dos (29 seconds ago.)fireplaces in nottingham (30 seconds ago.)pure-keratin.com (30 seconds ago.)burnsville quality (31 seconds ago.)galaxy a3 (31 seconds ago.)uv chng (33 seconds ago.)gabung (34 seconds ago.)