Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-10
Category: This site has not been categorized yet


Domain summary

Domain label
carrybag
Domain extension
co.kr
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is carrybag.co.kr ranked relative to other sites:

Percentage of visits to carrybag.co.kr from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Carrybag.co.kr registered?
A: Carrybag.co.kr was registered 4 months, 3 weeks, 1 day, 7 hours, 50 minutes, 48 seconds ago on Saturday, October 10, 2020.
Q: When was the WHOIS for Carrybag.co.kr last updated?
A: The WHOIS entry was last updated 4 months, 3 weeks, 1 day, 7 hours, 50 minutes, 48 seconds ago on Saturday, October 10, 2020.
Q: What are Carrybag.co.kr's nameservers?
A: DNS for Carrybag.co.kr is provided by the following nameservers:
  • ns4.makeshop.co.kr
  • ns3.makeshop.co.kr
Q: Who is the registrar for the Carrybag.co.kr domain?
A: The domain has been registered at .
Q: What is the traffic rank for Carrybag.co.kr?
A: Carrybag.co.kr has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Carrybag.co.kr each day?
A: Carrybag.co.kr receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Carrybag.co.kr resolve to?
A: Carrybag.co.kr resolves to the IPv4 address 203.238.183.81.
Q: In what country are Carrybag.co.kr servers located in?
A: Carrybag.co.kr has servers located in the South Korea.
Q: What webserver software does Carrybag.co.kr use?
A: Carrybag.co.kr is powered by Nginx webserver.
Q: Who hosts Carrybag.co.kr?
A: Carrybag.co.kr is hosted by KOREACENTER in South Korea.
Q: How much is Carrybag.co.kr worth?
A: Carrybag.co.kr has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Carrybag.co.kr Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Carrybag.co.kr Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Carrybag.co.kr

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Carrybag.co.kr

documenttopformlogid undefinedrvdocumentgetelementbyidcherrypickerlayerinnerhtmlviewssltopdocumentwritenlocationhrefshopmemberhtmltypereserveopentypeusernote1keyeventkeycode if key13limsindexof indexalertmicrosoft internet explorerviewssllogdocumentwritenexplorerif key13alert id return2nulltypeofnbsp 0elsecherrypickerwidthinternet explorerreturnmicrosoftalert returnisieiftypeof0id returnviewssltopkey13if navigatorappnameloginiframevardocumentformloginsubmitwindowopenhtmlemailhtmlemailheight100width100documenttopformlogsubmitnbspendstrfunctionkeyeventkeycodeeventkeycodedocumenttopformlogidreturn ifalert locationhrefshopmemberhtmltypereserveopentypeusernotemicrosoft internetlimsindexofiddocumenttopformlogidvaluenavigatorappnamenbsp 3viewssllognbsp nbspundefined typeofcharacternkeyeventkeycode ifindex3undefinedifalert idinternet

Longtail Keyword Density for Carrybag.co.kr

KeywordsOccurences
keyeventkeycode if key134
alert id return3
microsoft internet explorer3
nbsp 015
nbsp nbsp10
limsindexof index4
keyeventkeycode if4
if key134
undefined typeof4
alert id3
id return3
return if3
alert return3
alert locationhrefshopmemberhtmltypereserveopentypeusernote3
documenttopformlogid undefined3
if navigatorappname3
microsoft internet3
internet explorer3
nbsp 33
nbsp49
function37
033
if20
return16
alert13
undefined11
var11
index10
endstr8
iftypeof8
typeof6
else5
15
25
id5
n4
34
isie4
cherrypickerwidth4
key134
keyeventkeycode4
character4
limsindexof4
loginiframe4
documentformloginsubmit3
explorer3
null3
viewssllogdocumentwriten3
locationhrefshopmemberhtmltypereserveopentypeusernote3
rv3
windowopenhtmlemailhtmlemailheight100width1003
eventkeycode3
internet3
documenttopformlogid3
microsoft3
viewssllog3
navigatorappname3
viewssltopdocumentwriten3
viewssltop3
documenttopformlogidvalue3
documenttopformlogsubmit3
documentgetelementbyidcherrypickerlayerinnerhtml3

Who hosts Carrybag.co.kr?

Carrybag.co.kr Hosting Provider Information

Hosted IP Address:203.238.183.81
Hosted Hostname:203-238-183-servers.makeshop.co.kr
Service Provider:KOREACENTER
Hosted Country:South KoreaKR
Location Latitude:37.5112
Location Longitude:126.9741
Webserver Software:nginx

Is "KOREACENTER" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
KOREACENTER
0.0113%

HTTP Header Analysis for Carrybag.co.kr

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Sat, 10 Oct 2020 23:28:20 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
P3P: CP='CAO PSA CONi OTR OUR DEM ONL'
Content-Encoding: gzip

Carrybag.co.kr Domain Nameserver Information

HostIP AddressCountry
ns4.makeshop.co.kr 14.129.120.14
ns3.makeshop.co.kr 182.161.122.71


Need to find out who hosts Carrybag.co.kr?


Domain Registration (WhoIs) information for Carrybag.co.kr

 query : carrybag.co.kr

# KOREAN(UTF8)

도메인이름 : carrybag.co.kr
등록인 : 박찬
책임자 : 박찬
책임자 전자우편 : Login to show email
: 2004. 07. 13.
최근 정보 변경일 : 2010. 09. 01.
사용 종료일 : 2020. 07. 13.
정보공개여부 : N
등록대행자 : (주)아이네임즈(http://www.inames.co.kr)
DNSSEC : 미서명

1차 네임서버 정보
호스트이름 : ns3.makeshop.co.kr
IP 주소 : 182.161.122.71

2차 네임서버 정보
호스트이름 : ns4.makeshop.co.kr
IP 주소 : 14.129.120.14

네임서버 이름이 .kr이 아닌 경우는 IP주소가 보이지 않습니다.

# ENGLISH

Domain Name : carrybag.co.kr
Registrant : parkchan
Administrative Contact(AC) : parkchan
AC E-Mail : Login to show email
Date : 2004. 07. 13.
Last Updated Date : 2010. 09. 01.
Expiration Date : 2020. 07. 13.
Publishes : N
Authorized Agency : Inames Co., Ltd.(http://www.inames.co.kr)
DNSSEC : unsigned

Primary Name Server
Host Name : ns3.makeshop.co.kr
IP Address : 182.161.122.71

Secondary Name Server
Host Name : ns4.makeshop.co.kr
IP Address : 14.129.120.14

- KISA/KRNIC WHOIS Service -

Websites with Similar Names

Recently Updated Websites

7559.live (4 seconds ago.)Mornings.fun (4 seconds ago.)Thefamilymaid.com (7 seconds ago.)Enoiconsulting.com (8 seconds ago.)Extremehomeprofit.org (9 seconds ago.)Jsmitchell.org (9 seconds ago.)Beldongreatwindow.com (11 seconds ago.)Livingncrealestate.com (11 seconds ago.)Soling.group (11 seconds ago.)Fampilot.com (12 seconds ago.)Pearlassociate.com (14 seconds ago.)Orangecountyrealtycorp.com (16 seconds ago.)Schulaktioniy2017.com (17 seconds ago.)Jmstechnologies.net (18 seconds ago.)Allwaterproshop.com (19 seconds ago.)Insuranceplansmarket.com (19 seconds ago.)Mojsvet.net (21 seconds ago.)Zambianresourcecenter.com (22 seconds ago.)Christmasforomaha.net (25 seconds ago.)Chonow.com (29 seconds ago.)Str247.com (32 seconds ago.)Cryptocurrencywear.com (32 seconds ago.)Myblokchain.com (32 seconds ago.)Artbyjleighv.com (33 seconds ago.)Mirabusa.com (33 seconds ago.)Coveraddicted.com (34 seconds ago.)Seniorlac.com (35 seconds ago.)Dulcerok.com (35 seconds ago.)Krampusbazaar.com (36 seconds ago.)Sogoju.com (37 seconds ago.)

Recently Searched Keywords

qurbaan hua 19th november 2020 episode 117 video (1 second ago.)comments (2 seconds ago.)n03 (7 seconds ago.)chả mực bá kiến được làm từ những con mực tươi ngon từ vùng biển vịnh hạ long có chất lượng mực ngon nhất biển của việt nam (12 seconds ago.)chaplain (12 seconds ago.)wieso weshalb warum (www) (15 seconds ago.)4 thói quen không tốt cho tiền liệt tuyến (17 seconds ago.)cancedo (18 seconds ago.)211 33 1 (19 seconds ago.)chả mực bá kiến được làm từ những con mực tươi ngon từ vùng biển vịnh hạ long có chất lượng mực ngon nhất biển của việt nam (20 seconds ago.)db dman (23 seconds ago.)max-width768pxc-app-header (24 seconds ago.)texas style pulled pork (28 seconds ago.)0s colorffffffdisplayinline-blockmargincalc-1 (30 seconds ago.)ek-73 maddesi (31 seconds ago.)lzh (32 seconds ago.)led bulb health effects (34 seconds ago.)10481075108810861074108610813210791072108332 (35 seconds ago.)doktor auto (35 seconds ago.)colegarciainc (37 seconds ago.)heating systems (38 seconds ago.)streetwear (43 seconds ago.)2018 8220 (44 seconds ago.)akademija mm (45 seconds ago.)model number (45 seconds ago.)10481075108810861074108610813210791072108332 (46 seconds ago.)redesigned google play with new look (46 seconds ago.)discontinued (47 seconds ago.)c (49 seconds ago.)10481075108810861074108610813210791072108332 (50 seconds ago.)