Website Analysis Summary  |  ?????????????? | ?????????????
Low trust score  | 

Trust Score
Low Trust Score
Estimated worth
Estimated daily income
Estimated monthly income
0 has a Low Trust Score, and a Statvoo Rank of G. is hosted by GMO Internet,Inc in Japan. has an IP Address of and a hostname of

The domain was registered 1 decade 5 years 7 months ago by , it was last modified 4 years 7 months 2 weeks ago and currently is set to expire 3 years 7 months 2 weeks ago.

It is the world's 570,050 most popular site among over 300 million websites. has a total of 0 backlinks. gets approximately 1,147 unique visitors a day and 3,088 pageviews per day. has an estimated worth of $2,400.
An average daily income of approximately $10, which is wroughly $304 per month.

Whois information for

Full Whois Lookup for Whois Lookup

[ JPRS database provides information on network administration. Its use is ]
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h xxx/e'. ]

Domain Information:
[Domain Name] CATFOOD.JP

[Registrant] GMO Pepabo, Inc.

[Name Server]
[Name Server]
[Signing Key]

[Created on] 2004/05/27
[Expires on] 2018/05/31
[Status] Active
[Last Updated] 2017/06/01 01:05:09 (JST)

Contact Information:
[Name] GMO Pepabo, Inc.
[Email] Login to show email
[Postal code] 150-8512
[Postal Address] Cerulean Tower
26-1 Sakuragaoka-cho Shibuya-ku
[Phone] 03-5456-2622

Who hosts Web Server Information

Hosted IP Address:
Service Provider:GMO Internet,Inc
Hosted Country:JapanJP
Location Latitude:35.69
Location Longitude:139.69
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 12 Aug 2015 15:15:59 GMT
Server: Apache/2.0.63 (Unix) mod_ssl/2.0.63 OpenSSL/0.9.8e-fips-rhel5 PHP/5.2.8
X-Powered-By: PHP/5.2.8
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 20219
Content-Type: text/html; charset=UTF-8

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:1
H2 Headings:1
H3 Headings:1
H4 Headings:1
H5 Headings:1
H6 Headings:1
Total IFRAMEs:1
Total Images:12
Google Adsense:Not Applicable
Google Analytics:UA-3449245-9

Keyword Cloud for

truebreak forkeyhosting wordpress cloudishover truebreakhideflgelsewordpress cloud sslfunction var2200 10gmofooterclassname10 200domaindocumentcreateelementscriptgmoinvisible break forkeynoneweb hosting wordpressissvchiddenvarpdffunctionishdn10 200 10english domain web1webforkeybygmogmomessagehostingcloud sslisopenjps documentgetelementsbytagnamescript0storeappfunction ishover truebygmo gmojpzsourcewordpress cloudvar sfalsedomain web hostingblockfunctiondocumentgetelementbyidgmoservicesnavwrapstyledisplayifhideflg falsevalueenglish domain200 10 200shoplinkmakeshophosting wordpressssl storeappdocumentgetelementbyididqueryselectoralldatagroupcommongmocmdomain0classnameishiddenweb hostingishoverwordpressgmoinvisible breakgmoinvisiblefunction ishover falseprotocol0gmolsslsourcecloud ssl storeappshownenglishseohideflg truesfunction ishovernulldocumentgetelementsbytagnamescript0var s documentgetelementsbytagnamescript0isopenishover falseishdndomain webtrue vardocumentgetelementbyididqueryselectoralldatagroupcommongmocmdomain0classname gmoinvisiblecloudwindowfbql shoplink

Longtail Keyword Density for

10 200 107
200 10 2007
function ishover false6
function ishover true6
wordpress cloud ssl5
domain web hosting5
gmoinvisible break forkey5
english domain web4
cloud ssl storeapp4
hosting wordpress cloud4
var s documentgetelementsbytagnamescript03
web hosting wordpress3
function ishover12
break forkey9
10 2008
ishover false8
200 107
function var6
ishover true6
gmoinvisible break6
web hosting6
wordpress cloud5
domain web5
cloud ssl5
hosting wordpress4
bygmo gmo4
english domain4
l shoplink4
ssl storeapp4
var s3
hideflg true3
s documentgetelementsbytagnamescript03
documentgetelementbyididqueryselectoralldata-groupcommongmocmdomain0classname gmoinvisible3
true var3
hideflg false3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Japan Japan Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?