Catholic News, Commentary, Information, Resources, and the Liturgical Year | Catholic Culture

Safety: Low trust score
Year Founded: 2000
Global Traffic Rank: 25,115
Estimated Worth: $571,680

A chief provider and curator of Catholic information on the web since 1996. Our editorial voice, always faithful to the teachings of the Church, assists and inspires Catholic clergy and laity.



Domain summary

Last updated
2020-11-06
Domain label
catholicculture
Domain extension
org
Domain registered:
2000-03-08
Domain updated:
2020-11-06
Global Traffic Rank
25,115
Statvoo Rating
D
Trust Score
Low Trust Score
Estimated worth
$571,680
Estimated daily income
$794
Estimated monthly income
$24,151

Rank summary

How is catholicculture.org ranked relative to other sites:

Percentage of visits to catholicculture.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Catholicculture.org registered?
A: Catholicculture.org was registered 21 years, 1 month, 1 week, 2 days, 14 hours, 3 minutes, 43 seconds ago on Wednesday, March 8, 2000.
Q: When was the WHOIS for Catholicculture.org last updated?
A: The WHOIS entry was last updated 5 months, 1 week, 4 days, 14 hours, 3 minutes, 43 seconds ago on Friday, November 6, 2020.
Q: What are Catholicculture.org's nameservers?
A: DNS for Catholicculture.org is provided by the following nameservers:
  • dale.ns.cloudflare.com
  • mona.ns.cloudflare.com
Q: Who is the registrar for the Catholicculture.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Catholicculture.org?
A: Catholicculture.org ranks 25,115 globally on Alexa. Catholicculture.org has a Low Trust Score, and a Statvoo Rank of D.
Q: How many people visit Catholicculture.org each day?
A: Catholicculture.org receives approximately 66,128 visitors and 396,768 page impressions per day.
Q: What IP address does Catholicculture.org resolve to?
A: Catholicculture.org resolves to the IPv4 address 104.20.47.204.
Q: In what country are Catholicculture.org servers located in?
A: Catholicculture.org has servers located in the United States.
Q: What webserver software does Catholicculture.org use?
A: Catholicculture.org is powered by CloudFlare webserver.
Q: Who hosts Catholicculture.org?
A: Catholicculture.org is hosted by CloudFlare, Inc. in United States.
Q: How much is Catholicculture.org worth?
A: Catholicculture.org has an estimated worth of $571,680. An average daily income of approximately $794, which is roughly $24,151 per month.

Catholicculture.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Catholicculture.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Catholicculture.org

H1 Headings

14 :
  1. CatholicCulture.org
  2. Featured Content
  3. Daily Content
  4. Ordinary Time: November 5th
  5. Ordinary Time: November 4th
  6. Ordinary Time: November 3rd
  7. Ordinary Time: November 2nd
  8. Ordinary Time: November 1st
  9. Ordinary Time: October 31st
  10. Ordinary Time: October 30th
  11. Ordinary Time: October 29th
  12. Ordinary Time: October 28th
  13. Ordinary Time: October 27th
  14. Ordinary Time: October 26th

H2 Headings

12 :
  1. Thursday of the Thirty-First Week of Ordinary Time
  2. Memorial of St. Charles Borromeo, bishop
  3. Tuesday of the Thirty-First Week of Ordinary Time; Optional Memorial of St. Martin de Porres, religious
  4. The Commemoration of all the Faithful Departed (All Souls)
  5. Solemnity of All Saints
  6. Saturday of the Thirtieth Week of Ordinary Time; All Hallows' Eve
  7. Friday of the Thirtieth Week of Ordinary Time
  8. Thursday of the Thirtieth Week of Ordinary Time
  9. Feast of Sts. Simon and Jude, Apostles
  10. Tuesday of the Thirtieth Week of Ordinary Time
  11. Monday of the Thirtieth Week of Ordinary Time
  12. Free eBook:

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

49 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-3494905-2

Links - Internal

262:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Catholicculture.org

cwn and othermarriage3phil0block errorcount errorcountchurchesnbspfrench bishopsrulesnbspsee morecordileonehavenbsparchbishop cordileoneabortionsmirussubnavanimate scrollleftallholybadccfrumentiusvarcatholicsscrollother outletsprelateresultfundsfilm podcastsayssetsoutlets ordinary timeentersamesexblockordinary timeaddress must workhorizontaldrnewsdocumentgetelementbyidjstrinityfmamountstylecolornbspnewmass10pxjeff mirusmonthscrolledhnumbernone iffeastlockdownmarginfontsizeleft buttonlidr jeff miruseveprotestsnews from cwnpriests20pxyou must enterblock errorcountupnbspvatican officialemailpriestrestrictionschristiannbspfrenchnotsubnavanimatejeffculturemirus nbsppopemore newsconversionyearfalse elsearchbishopcaseconstitutionoctoberreadingsnonefindordinaryccnumtime octoberfathercatholicerrorcount 1media1 elsebishopnbspchurchgregoryfirstactionvar amountcivil unionssaintsgirlitsphil lawlercardinalfffpapalbackgroundclickcourt rulesthirtieth week0px 0pxworkbasilicacriteria the catholicelse if inputidsamesex marriageelsebadcc 1nbspvaticandepartedfreenovemberlawlererrorcount 1 elselawgiftelse ifchairmenyougovernmentfaithfulattack1truecolor fffyou mustaccountfaithful departedpopersquosfalsemust enterorderordinary time novemberamountsocial mediacallsaddress mustdownbishopsreturntodayleftcatholiccultureorgjesuitnavinputidtime novemberoverviewgodmust worklast nameofficialordinary time octobersetagainstseedayvictimsdocumentgetelementbyidjstrinityfmemailinnerhtmlhisdocumentgetelementbyidnavselectedsectioninnerhtmlnice basilicadocumentreadyfunctionsocialnbspsee more newssubscribesidebarnbsppopeother outlets ordinarypodcastbreaknewbuttonabortionleadertimeafterbutourthirtiethemail address mustdioceseliturgicalnavselectionvision0pxurgeresultstrerrorcountbanvaticandr jeffusfilmall saintsotheronlycivildiescelebratesmancovidnohe4pxmemorial of stabusecourtwhichreturn falsefunctionvar resulthomeaccusednamejerusalemnicenbspfederalnbspinmemorialdutiesarchdiocesenbspcameroonvar badccprayerdocumentgetelementbyidjstrinityfmemailstyledisplayfieldvalueappointedagainmostfunction setsduringerrorcount errorcount 1windowwidthdocumentgetelementbyidinputidvalueweekreligiousnbspprieststatemoresthistoricallyrightpointnbsptodaysmeetslastcwncommentaryweek of ordinarynavidcriteriacatholic filmtheirkilledsubnavlistwidthtoday the churchelectionnbsparchbishopviewportwidthyourifmore nbsptodaysoutlets ordinary2if scrolledhaddresspublicchurchchurch celebratesemail addressfrancisoveroutcatholic film podcastnbspseepopereturn false else0 varmore nbsptodays readingsnbsptodays readingspatriarchscrollleftmustwidthviewportwidth subnavlistwidthif inputidageunionsnbsptheerrorcount errorcountcolorfirst nameoutlets

Longtail Keyword Density for Catholicculture.org

KeywordsOccurences
news from cwn11
cwn and other11
nbspsee more news9
other outlets ordinary9
outlets ordinary time9
more nbsptodays readings8
week of ordinary7
ordinary time october6
dr jeff mirus6
ordinary time november5
errorcount errorcount 14
block errorcount errorcount4
you must enter4
errorcount 1 else4
email address must3
address must work3
else if inputid3
return false else3
today the church3
catholic film podcast3
memorial of st3
criteria the catholic3
ordinary time19
other outlets11
nbsptodays readings11
outlets ordinary9
more news9
nbspsee more9
phil lawler9
more nbsptodays8
else if7
jeff mirus6
time october6
dr jeff6
color fff5
if inputid5
thirtieth week5
time november5
you must5
nice basilica4
email address4
first name4
last name4
var amount4
must enter4
block errorcount4
errorcount errorcount4
errorcount 14
none if4
1 else4
civil unions4
church celebrates3
catholic film3
0 var3
viewportwidth subnavlistwidth3
left button3
subnavanimate scrollleft3
if scrolledh3
badcc 13
var badcc3
false else3
return false3
var result3
social media3
film podcast3
nbspvatican official3
must work3
address must3
0px 0px3
mirus nbsppope3
nbsparchbishop cordileone3
court rules3
all saints3
faithful departed3
same-sex marriage3
function sets3
nbspfrench bishops3
var39
if30
more21
else20
ordinary19
catholic19
time19
function18
nbsppope17
all15
pope15
bishops15
news15
cwn14
church14
other12
st11
nbsptodays11
readings11
court11
outlets11
november11
today10
name10
nbspsee10
errorcount10
0px9
lawler9
nbsparchbishop9
bishop9
return9
cardinal9
week9
phil9
block9
new9
09
none9
vatican8
you8
must8
mirus8
amount8
archbishop8
he8
false8
email8
18
color7
see7
result7
attack7
faithful7
state7
jeff7
10px7
right7
nbspin7
day7
documentgetelementbyidinputidvalue7
feast7
home7
priest7
abortion6
october6
viewportwidth6
saints6
dr6
subnavlistwidth6
us6
our6
background6
nbspvatican6
nbspfrench6
lockdown6
button5
covid5
width5
official5
gregory5
again5
thirtieth5
religious5
subscribesidebar5
your5
have5
fff5
last5
first5
abuse5
inputid5
left5
basilica5
scrolledh5
nice5
after5
navid5
account4
against4
his4
rules4
priests4
calls4
killed4
mass4
prayer4
patriarch4
says4
order4
nbspchurch4
down4
work4
election4
windowwidth4
catholiccultureorg4
resultstr4
christian4
action4
margin4
badcc4
font-size4
only4
not4
ccnum4
podcast4
24
free4
scroll4
point4
duties4
true4
unions4
law4
address4
most4
churches4
holy4
fieldvalue4
case4
civil4
enter4
francis4
media4
which3
departed3
government3
33
papal3
frumentius3
public3
documentgetelementbyidjstrinityfmamountstylecolor3
god3
popersquos3
victims3
break3
eve3
man3
during3
nbspnew3
jesuit3
their3
father3
marriage3
documentgetelementbyidjstrinityfmemailinnerhtml3
prelate3
appointed3
protests3
vision3
jerusalem3
over3
set3
same-sex3
liturgical3
funds3
gift3
nbsp3
4px3
20px3
social3
film3
criteria3
culture3
overview3
year3
commentary3
constitution3
month3
find3
number3
scrollleft3
subnavanimate3
horizontal3
click3
documentreadyfunction3
li3
sets3
documentgetelementbyidnavselectedsectioninnerhtml3
navselection3
nbspthe3
cordileone3
catholics3
age3
but3
girl3
accused3
no3
celebrates3
dies3
cameroon3
archdiocese3
abortions3
ban3
out3
memorial3
conversion3
its3
up3
leader3
chairmen3
nbspfederal3
restrictions3
urge3
nav3
historically3
diocese3
nbsppriest3
meets3
documentgetelementbyidjstrinityfmemailstyledisplay3

Who hosts Catholicculture.org?

Catholicculture.org Hosting Provider Information

Hosted IP Address:104.20.47.204
Hosted Hostname:104.20.47.204
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "CloudFlare, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
CloudFlare, Inc.
1.5273%

HTTP Header Analysis for Catholicculture.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 06 Nov 2020 01:20:52 GMT
Content-Type: text/html;charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
CF-Cache-Status: DYNAMIC
cf-request-id: 063cbd72670000e608762ea000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Server: cloudflare
CF-RAY: 5edafe970ba5e608-LHR
Content-Encoding: gzip

Catholicculture.org Domain Nameserver Information

HostIP AddressCountry
dale.ns.cloudflare.com 173.245.59.95
mona.ns.cloudflare.com 173.245.58.206


Need to find out who hosts Catholicculture.org?


Domain Registration (WhoIs) information for Catholicculture.org

 Domain Name: CATHOLICCULTURE.ORG
Registry Domain ID: D32331265-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2018-03-09T00:20:47Z
Creation Date: 2000-08-03T20:08:18Z
Registry Expiry Date: 2020-08-03T20:08:18Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Trinity Communications
Registrant State/Province: FL
Registrant Country: US
Name Server: DALE.NS.CLOUDFLARE.COM
Name Server: MONA.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-03-18T18:26:59Z

Websites with Similar Names

Catho-aixarles.fr
Église catholique dans le diocèse d'Aix-en-Provence et Arles
Catho-shanghai.com
catho-shanghai.com
Catho.be
Actualités - Le site de l'Eglise Catholique en Belgique
Catho.com
Empregos e Vagas de Empregos em todo o Brasil | Catho
Catho.com.br
Empregos e Vagas de Empregos em todo o Brasil | Catho
Catho.org
wwww.catho.org - le site catho qu'il vous faut!

Recently Updated Websites

Showmeshootingsupplies.us (2 seconds ago.)Td.vs3.com (2 seconds ago.)Telefonodeatencion.net (2 seconds ago.)Willkee.com (3 seconds ago.)Alvaro.net (4 seconds ago.)Zalabim.online (4 seconds ago.)Vibie.us (4 seconds ago.)Profpietro.com (4 seconds ago.)Nhaviet5s.com (4 seconds ago.)Fernsehpool.com (5 seconds ago.)Woowooshit.com (5 seconds ago.)Pelisplay.site (6 seconds ago.)Cryp2all.pro (6 seconds ago.)Neelaasman.page (6 seconds ago.)Mikeoldfield.net (6 seconds ago.)Catorce6.tienda (6 seconds ago.)Terraprints.com (6 seconds ago.)Usiconsulting.com (6 seconds ago.)Aavvlamarisma.es (6 seconds ago.)Kayakolata.com (7 seconds ago.)Okisce.com (7 seconds ago.)Duvalsschools.org (7 seconds ago.)Stgeorgearearealty.com (7 seconds ago.)Evang-kirche-wiblingen.de (7 seconds ago.)Rcpegasus.com (7 seconds ago.)Lochnessinvestigation.org (7 seconds ago.)Dmrealty.com.au (8 seconds ago.)Psnit.pl (8 seconds ago.)Kgfs.org.uk (8 seconds ago.)Weave.fit (8 seconds ago.)

Recently Searched Keywords

kuwait national day (1 second ago.)2020 7 (1 second ago.)php projects for mca students (1 second ago.)kuwai (1 second ago.)t bc (2 seconds ago.)askmehelpdesk (2 seconds ago.)cpanel control (4 seconds ago.)micro-blading (5 seconds ago.)24  (7 seconds ago.)arab sex vidio (7 seconds ago.)dropdownerror1962184419root (8 seconds ago.)kauf auf rechnung (9 seconds ago.)10  (10 seconds ago.)331 pm (11 seconds ago.)free job (14 seconds ago.)jangka (16 seconds ago.)cámaras caza (16 seconds ago.)�����������й�԰ (18 seconds ago.)points per (21 seconds ago.)forex vps our forex vps can be purchased in several prime locations near your favourite forex brokers in order to guarantee ultra low latency for super fast trade execution. (22 seconds ago.)wn.com (22 seconds ago.)baic motor (23 seconds ago.)privaut (24 seconds ago.)istocie (24 seconds ago.)anrietta (26 seconds ago.)भारत के वर्तमान शिक्षा मंत्री कौन है  (27 seconds ago.)vpns (28 seconds ago.)cerah (28 seconds ago.)rpm (33 seconds ago.)forgotten password (35 seconds ago.)