Azərbaycan Respublikasının Mərkəzi Bankı - Ana səhifə

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 34,267
Estimated Worth: $294,480
Last updated:2020-09-03


Domain summary

Domain label
cbar
Domain extension
az
Global Traffic Rank
34,267
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$294,480
Estimated daily income
$409
Estimated monthly income
$12,440

Rank summary

How is cbar.az ranked relative to other sites:

Percentage of visits to cbar.az from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Cbar.az registered?
A: Cbar.az was registered 6 months, 1 day, 12 hours, 10 minutes, 47 seconds ago on Thursday, September 3, 2020.
Q: When was the WHOIS for Cbar.az last updated?
A: The WHOIS entry was last updated 6 months, 1 day, 12 hours, 10 minutes, 47 seconds ago on Thursday, September 3, 2020.
Q: Who is the registrar for the Cbar.az domain?
A: The domain has been registered at .
Q: What is the traffic rank for Cbar.az?
A: Cbar.az ranks 34,267 globally on Alexa. Cbar.az has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Cbar.az each day?
A: Cbar.az receives approximately 34,085 visitors and 204,510 page impressions per day.
Q: What IP address does Cbar.az resolve to?
A: Cbar.az resolves to the IPv4 address 94.20.63.200.
Q: In what country are Cbar.az servers located in?
A: Cbar.az has servers located in the Azerbaijan.
Q: What webserver software does Cbar.az use?
A: Cbar.az is powered by Nginx webserver.
Q: Who hosts Cbar.az?
A: Cbar.az is hosted by Delta Telecom Ltd in Baku City, Baku, Azerbaijan.
Q: How much is Cbar.az worth?
A: Cbar.az has an estimated worth of $294,480. An average daily income of approximately $409, which is roughly $12,440 per month.

Cbar.az Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Cbar.az Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Cbar.az

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

19 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-131131414-1

Links - Internal

190:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Cbar.az

aktlarnazirlr kabinetininprezidentinin aktlarnazirlrpul nianlarstatistikastatistikhesablamalarxatir pulnotlar zr sonbazanad pul dvriyysisaxta12 493v hesablamalarpul nianlarstatistikastatistik blletenmakroiqtisadifaizstatistikapulkredit statistikasxariciportalblletenmakroiqtisadiolan pulblletenmakroiqtisadi statistikapulkreditsas istiqamtlripulsongnlk notlarv xatir pulolannianlartdavldnaktlarnazirlrnianlar zrazrbaycangenilndirilmsisiyastipulpul nianlarkazv xatirdnilrinpulprezidentininsiyasti komitsipul siyastisaszr dvltsilsilsiekonometriknotlarhesabatlarn yaymlanmas qrafikinrlrsiyastipul siyasti komitsipulproqramnnhquqi bazanadicmalpul siyastinin sasnianlarstatistikastatistik blletenmakroiqtisadihesabatlarnvblletenmakroiqtisadi statistikapulkredit statistikasxaricisistemlridni v hesablamalarsiyastinianlarsiyasti altlriterminlrzr sondvriyysisaxta pulnianlarstatistikastatistikyaymlanmasnotlar zrstatistikasxarici sektorunpullarmetalgenilndirilmsi zr dvltmlnpul dvriyysisaxta pulnianlar zr hquqisistemlridnibazanadstatistikasxarici sektorun statistikasmaliyyicmalpulbazanad pulsiyasti icmalpul siyastininstatistikasxaricistatistikasmaliyyhquqi bazanad pulhesabatlarn yaymlanmas2statistikasstatistiknianlartdavldn xarlm pulqrafikinrlr vnianlartdavldn xarlmkartlasiyasti icmalpulstatistikasstatistik hesabatlarn yaymlanmasdnipul dvriyysisaxtaistiqamtlripul siyastisistemlrininprezidentinin aktlarnazirlr kabinetininsektorun statistikasmaliyyzr hquqisiyastinin sas istiqamtlripulsiyastinin sasgenilndirilmsi zrdnilrin genilndirilmsi zrkabinetininpul nianlartdavldnpul nianlarkaz pullarmetalmrkzibankdvriyysisaxta pul nianlarstatistikastatistikxatirgnlk notlar zrmqallr silsilsiekonometriksiyastipul siyastixarlm pulxatir pul nianlartdavldnyaymlanmas qrafikinrlr vyaymlanmas qrafikinrlrsiyasti komitsipulzr son faiz01altlriterminlrrespublikas prezidentinin aktlarnazirlrelektronsistemlridni vstatistikapulkreditsektorunsas istiqamtlripul siyastikomitsipulgnlkdnilrin genilndirilmsidvltzrzr hquqi bazanadnianlarkaz pullarmetalinkiafqrafikinrlrrespublikasxarlmistiqamtlripuldvriyysisaxtanianlarstatistikastatistik blletenmakroiqtisadi statistikapulkreditrespublikas prezidentininmqallrstatistikasstatistik hesabatlarnicmalpul siyastininpul nianlartdavldn xarlmkomitsipul siyastinianlarkazhquqisiyastininson faizstatistikapulkredit statistikasxarici sektorunsistemikomitsipul siyasti icmalpul

Longtail Keyword Density for Cbar.az

KeywordsOccurences
prezidentinin aktlarnazirlr kabinetinin6
respublikas prezidentinin aktlarnazirlr6
zr son faiz4
pul nianlarkaz pullarmetal4
notlar zr son4
siyasti icmalpul siyastinin4
icmalpul siyastinin sas4
gnlk notlar zr4
dvriyysisaxta pul nianlarstatistikastatistik3
pul nianlarstatistikastatistik blletenmakroiqtisadi3
nianlarstatistikastatistik blletenmakroiqtisadi statistikapul-kredit3
blletenmakroiqtisadi statistikapul-kredit statistikasxarici3
hesabatlarn yaymlanmas qrafikinrlr3
statistikapul-kredit statistikasxarici sektorun3
statistikasxarici sektorun statistikasmaliyy3
statistikasstatistik hesabatlarn yaymlanmas3
bazanad pul dvriyysisaxta3
yaymlanmas qrafikinrlr v3
pul dvriyysisaxta pul3
siyastipul siyasti komitsipul3
hquqi bazanad pul3
zr hquqi bazanad3
siyasti komitsipul siyasti3
nianlartdavldn xarlm pul3
pul nianlartdavldn xarlm3
xatir pul nianlartdavldn3
v xatir pul3
genilndirilmsi zr dvlt3
dnilrin genilndirilmsi zr3
sistemlridni v hesablamalar3
sas istiqamtlripul siyasti3
siyastinin sas istiqamtlripul3
komitsipul siyasti icmalpul3
nianlar zr hquqi3
respublikas prezidentinin9
aktlarnazirlr kabinetinin6
prezidentinin aktlarnazirlr6
notlar zr4
nianlarkaz pullarmetal4
gnlk notlar4
pul nianlarkaz4
zr son4
siyastinin sas4
icmalpul siyastinin4
siyasti icmalpul4
son faiz4
dvriyysisaxta pul3
pul nianlarstatistikastatistik3
nianlarstatistikastatistik blletenmakroiqtisadi3
blletenmakroiqtisadi statistikapul-kredit3
statistikapul-kredit statistikasxarici3
statistikasxarici sektorun3
siyastipul siyasti3
qrafikinrlr v3
sektorun statistikasmaliyy3
statistikasstatistik hesabatlarn3
hesabatlarn yaymlanmas3
yaymlanmas qrafikinrlr3
bazanad pul3
mqallr silsilsiekonometrik3
pul dvriyysisaxta3
nianlartdavldn xarlm3
hquqi bazanad3
genilndirilmsi zr3
komitsipul siyasti3
sas istiqamtlripul3
istiqamtlripul siyasti3
siyasti altlriterminlr3
sistemlridni v3
v hesablamalar3
dnilrin genilndirilmsi3
zr dvlt3
zr hquqi3
olan pul3
v xatir3
xatir pul3
pul nianlartdavldn3
siyasti komitsipul3
xarlm pul3
nianlar zr3
12 4933
v31
pul21
zr13
siyasti12
respublikas10
dni9
prezidentinin9
kabinetinin8
sas6
sistemlrinin6
mrkzi6
aktlarnazirlr6
faiz5
mln5
hquqi5
son4
proqramnn4
yaymlanmas4
gnlk4
pullarmetal4
notlar4
nianlarkaz4
bank4
kartla4
04
14
icmalpul4
siyastinin4
sistemlridni4
hesablamalar4
dvlt4
azrbaycan3
qrafikinrlr3
statistikasstatistik3
hesabatlarn3
portal3
23
mqallr3
silsilsiekonometrik3
elektron3
altlriterminlr3
istiqamtlripul3
statistikasmaliyy3
statistikasxarici3
sektorun3
xatir3
genilndirilmsi3
dnilrin3
siyastipul3
komitsipul3
inkiaf3
sistemi3
nianlartdavldn3
statistikapul-kredit3
xarlm3
nianlar3
bazanad3
dvriyysisaxta3
nianlarstatistikastatistik3
blletenmakroiqtisadi3
olan3

Who hosts Cbar.az?

Cbar.az Hosting Provider Information

Hosted IP Address:94.20.63.200
Hosted Hostname:94.20.63.200
Service Provider:Delta Telecom Ltd
Hosted Country:AzerbaijanAZ
Location Latitude:40.3909
Location Longitude:49.8759
Webserver Software:nginx

Is "Delta Telecom Ltd" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%
Delta Telecom Ltd
0.0023%

HTTP Header Analysis for Cbar.az

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Thu, 03 Sep 2020 10:10:58 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=5
Vary: Accept-Encoding
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
X-Frame-Options: SAMEORIGIN
Content-Encoding: gzip

Cbar.az Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Cbar.az?


Domain Registration (WhoIs) information for Cbar.az

Websites with Similar Names

Cbar-project.com
投注平台-官网
Cbar.az
Azərbaycan Respublikasının Mərkəzi Bankı - Ana səhifə
Cbar.org
cbar.org is available for purchase - Sedo.com
Cbarange.ovh
Site en construction
Cbarbieri.com
Registrant WHOIS contact information verification
Cbarbosa.com
HugeDomains.com - Shop for over 300,000 Premium Domains

Recently Updated Websites

Acagarwal.com (8 minutes 19 seconds ago.)Eventgirlsmumbai.ind.in (26 minutes 8 seconds ago.)Magtech.in (32 minutes 22 seconds ago.)Registercompanyingeorgia.com (49 minutes 24 seconds ago.)Clickdigitalsolutions.co.uk (1 hour 5 minutes ago.)Udemyclone.bsetec.com (1 hour 9 minutes ago.)Claridgeconstruction.com.au (1 hour 37 minutes ago.)Hwceleb.com (1 hour 46 minutes ago.)Menetalk.com (1 hour 52 minutes ago.)Thenoteroom.com (1 hour 59 minutes ago.)Clickds.co.uk (2 hours 43 minutes ago.)Xn--viviendoelsueo-2nb.com (2 hours 45 minutes ago.)Orbitremovalists.com.au (2 hours 48 minutes ago.)Usehindi.com (2 hours 48 minutes ago.)Immigtoronto.com (3 hours 15 minutes ago.)Nursing.scientexconference.com (3 hours 46 minutes ago.)Uktablet.com (4 hours 30 minutes ago.)Sugarlandgaragedoors.com (4 hours 40 minutes ago.)Garagedoorspearland.com (4 hours 41 minutes ago.)Garagedoorrepairkatytx.com (4 hours 41 minutes ago.)Garagedoorrepairbellairetx.com (4 hours 42 minutes ago.)Garagedoorinspring.com (4 hours 43 minutes ago.)Ukrgeokart.com.ua (4 hours 43 minutes ago.)Garagedoorrepairconroetx.com (4 hours 44 minutes ago.)Garagedoorsrepairtomball.com (4 hours 44 minutes ago.)Garagedoorhumble.com (4 hours 47 minutes ago.)Garagedoorcypresstx.com (4 hours 47 minutes ago.)Meja.com.ua (4 hours 48 minutes ago.)Overheaddoorthewoodlands.com (4 hours 50 minutes ago.)Houstontxgaragedoorrepair.com (4 hours 51 minutes ago.)

Recently Searched Keywords

netflix (nflx) (1 second ago.)cover-wrapper height (5 seconds ago.)vlogs youtube (6 seconds ago.)органы исполнительной власти (9 seconds ago.)8:00 جوردي ينيك امه الالمانية ويمتعها مص بزازها الكبيرة – سكس امهات (15 seconds ago.)training software (17 seconds ago.)var reg (18 seconds ago.)imkan byk (18 seconds ago.)numerous (19 seconds ago.)products-tab td (20 seconds ago.)udemy php clone (21 seconds ago.)download it fromgoogle play (22 seconds ago.)power solutions (22 seconds ago.)lynda template (23 seconds ago.)bsetec (24 seconds ago.)edp 100 ml (24 seconds ago.)store click (25 seconds ago.)documentgetelementbyidmymobilestyledisplay (26 seconds ago.)blog spa (27 seconds ago.)fromgoogle play download (28 seconds ago.)marshall amp modifications (28 seconds ago.)udmey clone app development service (29 seconds ago.)50 average (30 seconds ago.)script live (31 seconds ago.)gurufinder (32 seconds ago.)pressupost online (32 seconds ago.)second extraordinary meeting of the conference of the parties to the convention on biological diversity (32 seconds ago.)lynda clone (33 seconds ago.)caperrorhtmlplease verify captcha (34 seconds ago.)fromgoogle play (35 seconds ago.)