Cbnpg.com.br Favicon Cbnpg.com.br

Cbnpg.com.br Website Thumbnail
Checking...
Paraná | CBN Ponta Grossa | Brasil
Low trust score
Add a review Change category Claim this site
As notícias dos Campos Gerais, na única rádio All News de Ponta Grossa.


Domain summary

Domain label
cbnpg
Domain extension
com.br
Domain registered:
2002-06-13
Domain updated:
2020-06-16
Domain expires:
2022-06-13
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is cbnpg.com.br ranked relative to other sites:

Percentage of visits to cbnpg.com.br from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Cbnpg.com.br registered?
A: Cbnpg.com.br was registered 18 years, 4 months, 1 week, 3 days, 22 hours, 24 minutes, 23 seconds ago on Thursday, June 13, 2002.
Q: When was the WHOIS for Cbnpg.com.br last updated?
A: The WHOIS entry was last updated 4 months, 1 week, 22 hours, 24 minutes, 23 seconds ago on Tuesday, June 16, 2020.
Q: What are Cbnpg.com.br's nameservers?
A: DNS for Cbnpg.com.br is provided by the following nameservers:
  • ns6.wixdns.net
  • ns7.wixdns.net
Q: Who is the registrar for the Cbnpg.com.br domain?
A: The domain has been registered at BR-NIC.
Q: What is the traffic rank for Cbnpg.com.br?
A: Cbnpg.com.br has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Cbnpg.com.br each day?
A: Cbnpg.com.br receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Cbnpg.com.br resolve to?
A: Cbnpg.com.br resolves to the IPv4 address 23.236.62.147.
Q: In what country are Cbnpg.com.br servers located in?
A: Cbnpg.com.br has servers located in the United States.
Q: What webserver software does Cbnpg.com.br use?
A: Cbnpg.com.br is powered by webserver.
Q: Who hosts Cbnpg.com.br?
A: Cbnpg.com.br is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Cbnpg.com.br worth?
A: Cbnpg.com.br has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Cbnpg.com.br?

Cbnpg.com.br Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Not Applicable

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Cbnpg.com.br

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Tue, 06 Oct 2020 05:59:09 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.cbnpg.com.br/
content-language: en
X-Wix-Request-Id: 1601963949.335483477325835322996
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: jeslxIFvDH4ulYwNNi 3Muwfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVivd4o9HMoDTVPhK7/s60Jl,2d58ifebGbosy5xc FRaloAIafGLnWVGmN/j8QY5rM2bKJ3lGhkys0BhbMU8ve2jaw5isL/iVgjKLHv9tpAbNg==,2UNV7KOq4oGjA5 PKsX47BfGVDRiOALEihGw5cYd8uQ=,m0j2EEknGIVUW/liY8BLLpKBwxGlovVE0fM/42WHC0w=,1wy2ILu/S4rlWT/R4rqCraVC924ZCWK YslPtYOMP4g=,WcrWvzU6 v56AFbpVWES8rmMV/V8ikSDjOEgK5wTFmEaWyug/ZdHQ36uOAkr89T0,nxVDKlf5lZ8xGkFSmm2J1sRRW9lM6mJEHqw5gYAStLqE3924Zbzy5rhx3LLqLxj/CONUzZLbexpS3PEZaUF96g==
Cache-Control: no-cache
Expires: -1

Cbnpg.com.br Domain Nameserver Information

HostIP AddressCountry
ns6.wixdns.net 216.239.32.100
ns7.wixdns.net 216.239.34.100


Need to find out who hosts Cbnpg.com.br?


WhoIs information for Cbnpg.com.br

 % Copyright (c) Nic.br
% The use of the data below is only permitted as described in
% full by the terms of use at https://registro.br/termo/en.html ,
% being prohibited its distribution, commercialization or
% reproduction, in particular, to use it for advertising or
% any similar purpose.
% 2020-09-07T21:02:34-03:00 - IP: 165.232.41.238

domain: cbnpg.com.br
owner: Sociedade Pitangui de Comunicação Ltda
owner-c: ANS599
tech-c: SPCLT66
nserver: ns6.wixdns.net
nsstat: 20200907 AA
nslastaa: 20200907
nserver: ns7.wixdns.net
nsstat: 20200907 AA
nslastaa: 20200907
created: 20020613 #894950
changed: 20200616
expires: 20220613
status: published

nic-hdl-br: ANS599
person: Anderson Soltovski
created: 20040210
changed: 20160915

nic-hdl-br: SPCLT66
person: SOCIEDADE PITANGUI DE COMUNICAÇÃO LTDA
created: 20180906
changed: 20180906

% Security and mail abuse issues should also be addressed to
% cert.br, http://www.cert.br/ , respectivelly to Login to show email
and Login to show email
whois.registro.br accepts only direct match queries. Types
% of queries are: domain (.br), registrant (tax ID), ticket,
% provider, CIDR block, IP and ASN.

Cbnpg.com.br Free SEO Report

Website Inpage Analysis for Cbnpg.com.br

H1 Headings

1 :
  1. Rádio, All News, Jornalismo

H2 Headings

6 :
  1. FALE COM A GENTE!
  2. 42.9 9994.1011
  3. RECEBA AS NOTÍCIAS DA RÁDIO CBN PG NO SEU CELULAR
  4. Região dos Campos Gerais soma 10.665 casos de coronavírus
  5. Ponta Grossa registra 54 novos casos de coronavírus nesta segunda-feira (05)
  6. Agência do Trabalhador oferece 325 vagas nesta terça-feira (06)

H3 Headings

2 :
  1. WhatsApp CBN
  2. Participe enviando sua mensagem para a CBN Ponta Grossa.

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

5 :

Total Images

8 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

9:
  1. No text
    https://www.cbnpg.com.br
  2. Início
    https://www.cbnpg.com.br
  3. Eleições 2020
    https://www.cbnpg.com.br/eleições2020
  4. Colunistas
    https://www.cbnpg.com.br/colunistas
  5. Podcasts
    https://www.cbnpg.com.br/podcast
  6. #mask-comp-k7z824xkimg-svg * {fill: #fff; stroke: #fff; stroke-width: 0;}
    https://www.cbnpg.com.br/coronavirus
  7. Região dos Campos Gerais soma 10.665 casos de coronavírus
    https://www.cbnpg.com.br/post/região-dos-campos-gerais-soma-10-665-casos-de-coronavírus
  8. Ponta Grossa registra 54 novos casos de coronavírus nesta segunda-feira (05)
    https://www.cbnpg.com.br/post/ponta-grossa-registra-54-novos-casos-de-coronavírus-nesta-segunda-feira-05
  9. Agência do Trabalhador oferece 325 vagas nesta terça-feira (06)
    https://www.cbnpg.com.br/post/agência-do-trabalhador-oferece-325-vagas-nesta-terça-feira-06

Links - Internal (nofollow)

0:

Links - Outbound

8:
  1. Ao VIvo
    https://social.radio.br/radio/mobile.php?url=cbnpg
  2. #mask-comp-kdpyivtgimg-svg * {fill: #fff; stroke: #fff; stroke-width: 0;}
    https://play.google.com/store/apps/details?id=com.cbnpg
  3. No text
    https://www.facebook.com/cbnpontagrossa/?epa=SEARCH_BOX
  4. No text
    https://www.instagram.com/cbnpg/
  5. No text
    https://twitter.com/cbnpg
  6. No text
    https://open.spotify.com/show/19BiLvYBgW8alFU5s56PnF
  7. No text
    https://www.deezer.com/br/show/1448332
  8. No text
    https://www.socialradio.com.br/radio/cbnpontagrossa

Links - Outbound (nofollow)

0:

Keyword Cloud for Cbnpg.com.br

n cursorarchetype paintbox display255 15menuspanhorizontalmenucolumnssubmenulayout1903511735root ulselectdatapreviewfocuscalc100 980px 05input1125155884nativeinputtextalign0 rgba149olsearchbox3010470100input inputwithoptions1325345868inputcomponent input1125155884nativeinputtextalignstrc1inlinecontentsearchbox3010470100input inputwithoptions1325345868inputcomponentfocuswithinbackgroundbrasilpageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaids6eahdesktopbgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaids6eahmobilebgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitemk6s9dr0pmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsetitleurif260916921a43dd54f4c6e960b012ade8aab3amv2pngwidth2000height1500altqualityunsharpmaskradius2amount1threshold0cachemaxagehours24advancedseodatatagstypemetapropspropertyogimagecontentf260916921a43dd54f4c6e960b012ade8aab3amv2pngmetawidth2000height1500typemetapropsnamedescriptioncontentas notcias dosrepeat paddingbox borderbox14px12em opensansserifdisplaynonespanhorizontalmenucolumnslayout852678809root horizontalmenucolumnslayout852678809pagewrapper300 normal 16px0 rgba149 11pgi5f7b85c09decb200187e4d360ahorizontalmenucolumnslayout852678809rootcontrollerparttypestylek9e6zm73navcontainersvgcontainern displaycbn ponta grossatransition opacityborderwidth2px borderstylesolidbordercolorrgba249 249normal normal 14px14emsafari opera1 stylek9cugrqcsearchbox1252846306rootsearchbox3010470100previewstatefocusstylek9cugrqcsearchbox1252846306rootsearchbox3010470100previewstatehoversearchbox3010470100input inputwithoptions1325345868inputcomponent input1125155884nativeinputstylek9cugrqc255 09fontsize0margintop5pxinputwithoptions1325345868inputcomponent input1125155884nativeinputtextalignnntypetitlechildrenparan02s ease09 100bloghovercontainerelementcolorcolorf2ad2ecompkevvh4v9horizontalmenu2645433724menu lilastoftypesearchbox3010470100input inputwithoptions1325345868inputcomponentzindexfontfamilyhelvetica neue helveticaneuew0155romainputwithoptions1325345868inputcomponent input1125155884nativeinputstylek9cugrqc0 03paddingbottom 0pointerevents1 stylek9e6zm73navcontainerhelveticaneuew1055roma helveticalineardos campos geraisunsetinset 0iframe positionabsolutewidth100height100overflowhidden09 0open sanssansseriftextdecoration lineheightnormalfontstyleinheritfontweightinheritwebkittextdecorationinherittextdecorationinheritcompkevvh4v9hiddenstylek9cugrqcsearchbox1252846306root searchbox3010470100input inputwithoptions1325345868inputcomponentwidth100height100backgroundrgba255 255 255dostylek9e6zm73navcontainerrightdirectionall 02s easenica rdio allflexnwebkitcolumnbreakinsideponta grossasearchbox3010470100rootsearchbox3010470100previewstatehoverblack transparenthorizontalmenuitem1808041630labelblogpostcategorypostcontainerhiddentextoverflow ellipsis stylek9cugrqc0width204 204100heightbrasilpageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaids6eahdesktopbgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaids6eahmobilebgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitemk6s9dr0pmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsetitleurif260916921a43dd54f4c6e960b012ade8aab3amv2pngwidth2000height1500altqualityunsharpmaskradius2amount1threshold0cachemaxagehours24advancedseodatatagstypemetapropspropertyogimagecontentf260916921a43dd54f4c6e960b012ade8aab3amv2pngmetawidth2000height1500typemetapropsnamedescriptioncontentas notciashorizontalmenucolumnslayout852678809listwrapper lilastoftypeborderwidth2px12px stylek9cugrqclineargradient180deg rgba149margintop unsetpaintboxnn14px14em0pxneue28px12emrgba0001 stylek9cugrqcsearchbox3010470100rootsearchbox3010470100withoverridefontsizesanssansserif color000000ahorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtl0 2pxrgba0001100 stylek9cugrqc249 249 1backgroundcolorrgba255sanssansseriftransition inheritnarchetype boxnlifirstoftype spanhorizontalmenucolumnslayout852678809root1pxbordercolor rgba00006spanhorizontalmenucolumnssubmenulayout1903511735root horizontalmenucolumnssubmenulayout1903511735pagewrapper horizontalmenucolumnssubmenulayout1903511735listwrappersafaritransparent stylek9cugrqcfontfamilyhelvetica neuestylek9e6zm73navcontainerarrowstylek9e6zm73navcontainercenterdirection11 09searchbox3010470100buttonborderwidth 0 003035compkevvh4v9dropdown943170449dropdowncontent dropdowncontent372933412dropdownoptiondropdownoption1477900353selectedinputwithoptions1325345868inputcomponentzindexsansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenter12px12em open sanssansseriftextdecorationcasosponta229 214defaultpagebreakinside avoid firefoxarialfont normal2font normal normalpgsclkevvh4v912800 divrgba0 0breakinsidehorizontalmenucolumnslayout852678809pagewrapper horizontalmenucolumnslayout852678809listwrapper11 11rgba149 11borderwidth2px borderstylesolidbordercolorrgba249nntypetitlechildrenparan cbn14pxmaxwidth300 normalbrasilpageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaids6eahdesktopbgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaids6eahmobilebgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitemk6s9dr0pmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsetitleurif260916921a43dd54f4c6e960b012ade8aab3amv2pngwidth2000height1500altqualityunsharpmaskradius2amount1threshold0cachemaxagehours24advancedseodatatagstypemetapropspropertyogimagecontentf260916921a43dd54f4c6e960b012ade8aab3amv2pngmetawidth2000height1500typemetapropsnamedescriptioncontentasrua12px12emunsetnvarsearchbox3010470100iconspacing stylek9cugrqcsearchbox3010470100buttonrgba255 255color000000lifirstoftypegrossa metakeywordsseopagetitleseoparanbloglinkhovercolorhovercolorf2ad2ecompkevvh4v9 isdesktopborderdropdown943170449dropdowncontent0 1div pgi5f7b8506f7290c0017387e6b1 imageitemcanvas13px12empositionfixeddos14px14em libreblogposthomepagepostcontainer0 0 035compkevvh4v9dropdowncontent372933412dropdownoptionsearchbox3010470100iconstylek9cugrqc searchbox3010470100rootsearchbox3010470100disabledrgba00006submenublock transitionlilastoftype spanhorizontalmenucolumnslayout852678809rootboxshadow nonehorizontalmenu2645433724menunormal normal 300operapointer stylek9cugrqc100 round repeat0bordercolor rgba255blogposttextfontfontnormal normalponta grossa nntypetitlechildrenparanspanhorizontalmenucolumnslayout852678809rootsearchbox3010470100buttonfocusable1810053796focus searchbox3010470100buttoniconcolor rgba00shorizontalmenucolumnssubmenulayout1903511735listwrapper lifirstoftypetransition opacity 1swidth 100npositionstaticboxshadow000normal 300 normaldropdowncontent372933412dropdownoptiondropdownoption1477900353selectedgrossa brasilpageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaids6eahdesktopbgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaids6eahmobilebgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitemk6s9dr0pmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsetitleurif260916921a43dd54f4c6e960b012ade8aab3amv2pngwidth2000height1500altqualityunsharpmaskradius2amount1threshold0cachemaxagehours24advancedseodatatagstypemetapropspropertyogimagecontentf260916921a43dd54f4c6e960b012ade8aab3amv2pngmetawidth2000height1500typemetapropsnamedescriptioncontentas notciasposition absolutetoprdiohelveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055romagrossasearchbox3010470100rootsearchbox3010470100disablednone importantsearchbox3010470100inputhoverscroll urlhttpsstaticwixstaticcommediae3bf95a9cdd441ebaf55f139b1b5a7b8pngv1fillw52h52alclg1e3bf95a9cdd441ebaf55f139b1b5a7b8pngformattervaluese3bf95a9cdd441ebaf55f139b1b5a7b8png3737 rgb149urlhttpsstaticwixstaticcommediae3bf95a9cdd441ebaf55f139b1b5a7b8pngv1fillw52h52alclg1e3bf95a9cdd441ebaf55f139b1b5a7b8pngformattervaluese3bf95a9cdd441ebaf55f139b1b5a7b8png3737 rgb149 11980pxneue helveticaneuew0155romanormal 28px12emopen sanssansserif color000000blackall 02ssearchbox3010470100rootsearchbox3010470100isexpandablestylek9e6zm73navcontainerarrowstylek9e6zm73navcontainerleftdirectiondropdown943170449dropdowncontent dropdowncontent372933412dropdownoptiondropdownoption1477900353hovered2px9normal 16px16px12em open sanssansseriftextdecorationhorizontalmenucolumnssubmenulayout1903511735pagewrapper horizontalmenucolumnssubmenulayout1903511735listwrapperpaddingrightfonthiddentextoverflow ellipsisscrollnormal normal 28px12em4pxno0left0 2px 0bordercolorpgi5f7b78d866115f0017e7d7862 imageitemcanvashelveticaneuew0155roma helveticaneuew0255romalb1itemscontainerstylek9cugrqc searchbox3010470100input dropdown943170449dropdowncontentpagebreakinside avoidspanhorizontalmenucolumnssubmenulayout1903511735rootarchetypeunset importantstylekcdqwz4hnews de pontadefault importantnormal normal normalspanhorizontalmenucolumnslayout852678809root horizontalmenucolumnslayout852678809pagewrapper horizontalmenucolumnslayout852678809listwrapperbloglinkhovercolorhovercolorf2ad2ecompkevvh4v9bloglinkhashtagcolorcolorf2ad2ecompkevvh4v9archetype paintboxnn displaybackgroundimagecursor default importantspanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3ltr09 0 rgba149searchbox3010470100input inputwithoptions1325345868inputcomponentfocuswithinbackground rgba2551ssuggestionheader1593519615rootstylek9cugrqcsearchbox1252846306root searchbox3010470100inputdropdown943170449contentvisiblemargin0lineheightnormalletterspacingnormal txtnewsearchbox3010470100rootsearchbox3010470100previewstatefocustophiddennhorizontalmenuitem1808041630containerlineheightnormalcompkevvh4v9helvetica arial sansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncentersearchbox3010470100input popover649285268popoverelementstylek9cugrqcpaddingtop0auto autocentersearchbox3010470100iconstylek9cugrqcsearchbox1252846306rootsearchbox3010470100disabledwidthpaddingbottomnonennninfosvgtypeshapeviewbox010stylek9e6zm73navcontainercenterdirectionsearchbox3010470100rootsearchbox3010470100previewstatehover searchbox3010470100input255 255div pgi5f7b85c09decb200187e4d360 imageitemcanvaspositionabsolutetop0left0color373737width100height100solidbordercolorhorizontalmenucolumnssubmenulayout1903511735pagewrapper horizontalmenucolumnssubmenulayout1903511735listwrapper lifirstoftypehelveticaneuew1055roma helvetica arialhelveticaneuew1055romasolidborderwidthblockspanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3ltr horizontalmenu2645433724menuul lifirstoftypestylek9cugrqc searchbox3010470100roothorizontalmenu2645433724menu lifirstoftypeselectfocusnormal normalautoborderbox 0suggestion3456478798contentmarginleftitemnormal 13px12emcampos gerais nadisplay blocknormal normal 12px12emflexalignitems centerboxsizing0 0 03div pgi5f7b85c09decb200187e4d360 imageiteminheritoldirrtldiv pgi5f7b78d866115f0017e7d7862marginrepeatrgba00006 stylek9cugrqcdiv pgi5f7b85c09decb200187e4d360notcias dosmarginbottomellipsis stylek9cugrqcimageitemcanvasopacity 1 transitionoverflowhidden03 stylek9cugrqc searchbox3010470100rootsearchbox3010470100disabledopacity 1sdisplaynoneponta grossa brasilpageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaids6eahdesktopbgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaids6eahmobilebgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitemk6s9dr0pmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsetitleurif260916921a43dd54f4c6e960b012ade8aab3amv2pngwidth2000height1500altqualityunsharpmaskradius2amount1threshold0cachemaxagehours24advancedseodatatagstypemetapropspropertyogimagecontentf260916921a43dd54f4c6e960b012ade8aab3amv2pngmetawidth2000height1500typemetapropsnamedescriptioncontentaspaintboxsvgsearchbox3010470100inputdropdown943170449contentvisible50pxwidthhorizontalmenucolumnslayout852678809pagewrapperarchetype paintboxnnpaddingmarginleft calc100input1125155884nativeinputstylek9cugrqcminwidthdefault stylek9cugrqcimageitemcanvasopacity 1borderbottomwidth 0archetype paintbox13px12em openborderboxwidthsearchbox3010470100rootsearchbox3010470100disabled searchbox3010470100buttonrgba235 229webkitcolumnbreakinside avoid50pxmaxheight 50pxwidth 09emheightlayoutchilddisplaydropdown14pxminheight1compkevvh4v95px stylek9cugrqcimageitemcanvascolor 6c3c17searchbox3010470100root8px 0controllerparttype layoutchilddisplaydropdownauto scroll03 stylek9cugrqcsearchbox1252846306rootsearchbox3010470100disabled searchbox3010470100inputn archetype textnpgsclkevvh4v90160 diveasehelveticaneuew0255roma helveticaneuew1055roma helveticasearchbox3010470100buttoniconcolor rgba0rgb149roundultxtnew olcenterboxsizingimportantpointerevents nonescroll lineargradient180degnormal normal 13px12em16px12em opencolor04s ease5px 5pxstylek9cugrqcsearchbox1252846306rootsearchbox3010470100isexpandablenone stylek9cugrqcsearchbox1252846306rootdisplaywebkitboxwebkitlineclampbreakinside avoidhelveticaneuew0155romafontfamilyhelvetica14px stylek9cugrqcarchetype text controllerparttypestylek9cugrqc searchbox3010470100input inputwithoptions1325345868inputcomponentstylek9cugrqcsearchbox1252846306root searchbox3010470100input dropdown943170449dropdowncontentspanhorizontalmenucolumnslayout852678809root ulnormal 13px12em openpgi5f7b8506f7290c0017387e6b1 imageitemcanvascursor defaultsearchbox3010470100button buttonnext3654178621contentstylek9cugrqcboxshadowinputwithoptions1325345868inputcomponentall1s linearsearchbox3010470100root suggestion3456478798rootnormal 300helveticaneuew0255romaboxnwidth100height100importantleftautosearchbox3010470100buttonborderwidthcamposnormal robotoavoid firefox50pxwidth 09emheightimportantnhorizontalmenucolumnssubmenulayout1903511735pagewrapper horizontalmenucolumnssubmenulayout1903511735listwrapper lilastoftypesuggestionheader1593519615rootbackgroundgerais na100nhorizontalmenucolumnslayout852678809pagewrapper horizontalmenucolumnslayout852678809listwrapper lilastoftypetextoverflow12px12em opengrossa nntypetitlechildrenparanchromeflexalignitems0 1 stylek9cugrqcsearchbox1252846306root255 1 stylek9e6zm73navcontainernormal normal 16px12emvisibilitysanssansseriftextdecorationstylek9cugrqcsearchbox1252846306root suggestion3456478798rootrobotosearchbox3010470100inputfocuswithinimageitemoverflow hiddenninputwithoptions1325345868inputcomponentfocuswithinbackgroundrdio allstylablehorizontalmenu4089050981menuitemrdio all newspagebreakinsiden margintopnotcias dos camposnormal 14px14em librecalc100lilastoftype a n09 100 roundimageitemcanvasopacitycolor0099fftextdecorationunderlinecursorpointerminheightautopaddingtop 0searchbox3010470100root suggestionheader1593519615rootcampos geraisnonebordern flexgrow0marginbottom unsetflexgrow inheritsearchbox3010470100buttonfocusable1810053796focusposition0 stylek9cugrqcsearchbox1252846306rootnewsbloghovercontainerelementfillfillf2ad2ecompkevvh4v9horizontalmenucolumnslayout852678809rootstylek9cugrqcsearchbox1252846306rootblogposttextfontfontnormalverticaloverflownone stylek9cugrqcol ul50pxmaxheight 50pxwidthtransitionavoid iesearchbox3010470100buttoniconcolor rgba0001 stylek9cugrqcstylek9cugrqc searchbox3010470100rootsearchbox3010470100disabled searchbox3010470100inputsearchbox3010470100buttoniconstylek9cugrqcsearchbox1252846306root1 stylek9cugrqcsearchbox1252846306rootarchetype boxn displayhorizontalmenucolumnslayout852678809listwrapperautonwidth100height100backgroundrgba255round repeatstylek9cugrqc searchbox3010470100inputdropdown943170449contentvisibleboxsanssansseriftextdecoration lineheightnormalfontstyleinheritfontweightinheritwebkittextdecorationinherittextdecorationinheritcompkevvh4v9display flexsearchbox3010470100buttonstylek9cugrqcmarginleft calc100 980px09fontsize0margintop5pxsearchbox3010470100buttonfocusable1810053796focus searchbox3010470100buttoniconcolorease visibilitylineheightnormalfontstyleinheritfontweightinheritwebkittextdecorationinherittextdecorationinheritcompkevvh4v9iframewebkitfullscreenavoid ie 10stylek9cugrqc searchbox3010470100rootsearchbox3010470100isexpandablecolor ffffffie16px normalflexpaintboxnn displaybackgroundcolor ffffffbordertopwidthtxtnew16px normal robotonninfosvgtypeshapeviewbox0 0stylek9cugrqc searchbox3010470100inputnica rdio06display block transitionmargin0lineheightnormalletterspacingnormal50pxmaxheightborderbox transitionlisearchbox3010470100input dropdown943170449dropdowncontentfirefox0 0 1backgroundcolornormal 28px12em opentextn display flexnboxsizing borderbox transitioncolumns menucbn pontablock transition inheritgrossa metakeywordsseopagetitleseoparan cbnstylek9e6zm73navcontainersanssansseriftextdecoration lineheightnormalcompkevvh4v9selectdatapreviewerror stylek9e6zm73navcontainerarrowfffstrc1dataresponsive0 0 2pxnormal 16px12em openinsetrepeat paddingboxpopover649285268arrowborderwidth25s11 09 100pgi5f7b78d866115f0017e7d7862604sdivarial sansserifdisplaynonesearchbox3010470100iconcolor rgba0 0alignitems centern archetype boxn255 255 09fontsize0margintop5pxblogpostpostlistpostcontainerdiv pgi5f7b8506f7290c0017387e6b1urlhttpsstaticwixstaticcommediae3bf95a9cdd441ebaf55f139b1b5a7b8pngv1fillw52h52alclg1e3bf95a9cdd441ebaf55f139b1b5a7b8pngformattervaluese3bf95a9cdd441ebaf55f139b1b5a7b8png3737 rgb149visiblejustifycontentnntypetitlechildrenparan cbn pontapopover649285268popoverelementstylek9cugrqcborderstylesolidbordercolorrgba249 249avoid chrome03 stylek9cugrqcsearchbox1252846306rootsearchbox3010470100disabledbackgroundcolor 6c3c170 0auto autoborderradius0horizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollsearchbox3010470100input inputwithoptions1325345868inputcomponentstylek9cugrqc051 transitiondo trabalhadorpositionabsolutewidth100height100overflowhiddenrgba255 255 255isdesktopstylek9cugrqc searchbox3010470100root suggestion3456478798rootopen sanssansserifbordercolorsearchbox3010470100buttoniconcolor rgba0 0helveticaneuew0255roma helveticaneuew1055roma80borderradiusalignitemsdropdowncontent372933412dropdownoptiondropdownoption1477900353hovered13px12em open sanssansseriftextdecorationboxsizing borderboxn0ntrabalhadoreulopacitynestaauto scroll lineargradient180degpositionstaticboxshadow000 0metakeywordsseopagetitleseoparan cbn pontapgsclkevvh4v90160borderboxnborderbox transition inherithorizontalmenucolumnslayout852678809listwrapper lifirstoftypeinput1125155884nativeinputpaddingleftpgi5f7b78d866115f0017e7d7862 imageitemnormalultxtnewn archetypestylek9e6zm73navcontainerarrowverticaloverflow hiddentextoverflowhorizontalmenucolumnslayout852678809pagewrapper horizontalmenucolumnslayout852678809listwrapper lifirstoftypetext controllerparttypechrome safari operapositionfixed importantleftautostylek9cugrqc searchbox3010470100rootsearchbox3010470100previewstatehover searchbox3010470100inputnotcias0 0autohiddentextoverflow11 09 0paddingboxstylek9cugrqc searchbox3010470100rootsearchbox3010470100isexpandable searchbox3010470100inputhorizontalmenu2645433724menu n16px12em255 255 1bloglinkhoverfillhoverfillf2ad2ecompkevvh4v9blogposttextcolorcolor000000compkevvh4v9maxwidth 100rgba0none stylek9cugrqc searchbox3010470100rootminheightauto importantarchetype textsearchbox3010470100input dropdown943170449dropdowncontent dropdowncontent372933412dropdownoptiondropdownoption1477900353hoverednormal 12px12em open02s ease visibilitylilastoftypeopacity 1s linear0 0bordertopwidth 06c3c17popover649285268arrowborderwidth 5pxstylek9e6zm73repeaterbuttonlabelnormal 14px14em1s linear backgroundimageboldtextn controllerparttypewebkitcolumnbreakinside avoid chrome249 2490 importantnowraphelvetica arial sansserifdisplaynoneul lilastoftypeoverflowsearchbox3010470100input dropdown943170449dropdowncontent dropdowncontent372933412dropdownoptiondropdownoption1477900353selectedcolor373737fontfamilyhelvetica neue helveticaneuew0155romabox display0bordercolor rgba255 255positionfixed importantleftauto importantzindex50positionabsolutetop0right0bottom0left0selectdataerrortrue4lineargradient180degdiv pgi5f7b78d866115f0017e7d7862 imageitemrgba255leftvarsearchbox3010470100iconspacingheight 100nlineargradient180deg rgba149 11249 1backgroundcolorrgba255ahorizontalmenucolumnslayout852678809root uln0rightopen255 255 03ahorizontalmenucolumnssubmenulayout1903511735root uliframeall newsahorizontalmenucolumnssubmenulayout1903511735root5px1 stylek9cugrqcsearchbox1252846306root searchbox3010470100inputselecthoversuggestion3456478798thumbnailwidthtopautobottom0importantzindex50paintbox display blockponta grossa metakeywordsseopagetitleseoparanurlhttpsstaticwixstaticcommediae3bf95a9cdd441ebaf55f139b1b5a7b8pngv1fillw52h52alclg1e3bf95a9cdd441ebaf55f139b1b5a7b8pngformattervaluese3bf95a9cdd441ebaf55f139b1b5a7b8png3737blogposttextfontfontnormal normal normal249 1backgroundcolorrgba255 2552px 0bordercolortxtnew ulinputwithoptions1325345868inputcomponent input1125155884nativeinputpaddingleftflexgrowstylek9cugrqc searchbox3010470100rootsearchbox3010470100previewstatefocussearchbox3010470100buttonborderwidth 0searchbox3010470100buttoniconcolordisplayinlineblockeaseoutsearchbox3010470100buttonhoversearchbox3010470100iconcolor rgba0bloghovercontainerelementcolorcolorf2ad2ecompkevvh4v9 isdesktopdos camposn nninfosvgtypeshapeviewbox0relativepositionstaticboxshadow000 0 0borderstylesolidbordercolorrgba249horizontalmenucolumnslayout852678809menuitemcolor373737fontfamilyhelveticanumbernormal 16px normalgeraispaddingbox borderboxarchetype paddingboxmargin 0ifwhitespace0 03 stylek9cugrqcarchetype box displayinputwithoptions1325345868inputcomponentstylek9cugrqcmargintopbox display flexdisplay flexn14pxmaxwidth 50pxmaxheight1backgroundcolorrgba255 255stylek9e6zm73navcontainerleftdirection10pximportantleftauto importantzindex50rgb149 11nadasearchbox3010470100input inputwithoptions1325345868inputcomponentn archetype paintboxnnn cursor defaultnormal 12px12emsystemui0autonica0 importantn1 transition opacitysearchbox3010470100iconstylek9cugrqcgrossa nntypetitlechildrenparan cbnheight 0arial sansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenteroverflow hiddenwidth 100pgi5f7b8506f7290c0017387e6b1 imageitem1pxbordercolor rgba00006 stylek9cugrqc0bottom09emheightinputwithoptions1325345868inputcomponentfocuswithinbackground rgba255stylek9cugrqcsearchbox1252846306rootsearchbox3010470100previewstatefocusbordercolor transparentcalc100 980pxboxsizing borderboxcenter stylek9cugrqcnowrapnborderboxrgba149metakeywordsseopagetitleseoparanpointernone14pxminheight 14pxmaxwidth 50pxmaxheight1 stylek9cugrqctextnparahorizontalmenu2645433724menu listylek9cugrqc suggestion3456478798rootsuggestion3456478798mobileviewsuggestion3456478798rootsuggestion3456478798mobileviewscroll lineargradient180deg rgba149000000inputwithoptions1325345868inputcomponentfocuswithinbackground rgba255 2550 stylek9cugrqcchrome safarigerais na nica28px12em open1pxselectdatapreviewerrorsuggestionfooter2422147164rootcenternsearchbox3010470100rootsearchbox3010470100isexpandable searchbox3010470100input3color373737fontfamilyhelvetica neueie 10255 03searchbox3010470100input inputwithoptions1325345868inputcomponent input1125155884nativeinputpaddinglefthelvetica arialneue helveticaneuew0155roma helveticaneuew0255romaarchetype box28px12em open sanssansseriftextdecorationhorizontalmenucolumnssubmenulayout1903511735listwrapperdiv pgi5f7b78d866115f0017e7d7862 imageitemcanvasarchetype textn controllerparttype0bordercolorhorizontalmenusubitem329750698labelna nica02spgi5f7b85c09decb200187e4d360 imageitemcanvas0 0 0opacity1iframewebkitfullscreen minheightauto importantn widthborderbottomwidthpgi5f7b85c09decb200187e4d360 imageitemsearchbox3010470100buttoniconcolor rgba000112pxstylek9cugrqcsearchbox1252846306rootsearchbox3010470100disabled searchbox3010470100inputopen sanssansseriftextdecoration lineheightnormalcompkevvh4v9round repeat paddingboxpaddingbox borderbox 0229 229ffffffstylek9e6zm73navcontainerarrow stylek9e6zm73navcontainersvgcontainerinset 0 0rgba235n nninfosvgtypeshapeviewbox0 0searchbox3010470100rootsearchbox3010470100disabled searchbox3010470100input8pxsearchbox3010470100input1pxbordercolorstylek9e6zm73navcontainerarrowstylek9e6zm73navcontainerrightdirectionellipsistransition inheritcolumnspaintbox display14px14pxminheight 14pxmaxwidthbuttonnext3654178621contentstylek9cugrqc20pxblogiconfillfill000000compkevvh4v9helveticatext controllerparttype layoutchilddisplaydropdown14px12em100 roundtransparentn n nninfosvgtypeshapeviewbox0searchbox3010470100inputcontainerwidthcbnlifirstoftype spanhorizontalmenucolumnssubmenulayout1903511735rootverticaloverflow hiddentextoverflow ellipsistransparent blackpgsclkevvh4v912800n heightpgi5f7b8506f7290c0017387e6b1searchbox3010470100iconcolor03 stylek9cugrqcavoidscroll urlhttpsstaticwixstaticcommediae3bf95a9cdd441ebaf55f139b1b5a7b8pngv1fillw52h52alclg1e3bf95a9cdd441ebaf55f139b1b5a7b8pngformattervaluese3bf95a9cdd441ebaf55f139b1b5a7b8png3737stylek9cugrqcsearchbox1252846306rootsearchbox3010470100isexpandable searchbox3010470100inputmenu itemspanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtl horizontalmenu2645433724menumarginleftvariframewebkitfullscreen minheightautoboxn displaylifirstoftype a ncursor2px 0bordercolor rgba255transparent transparentstylek9cugrqcstylek9cugrqcsearchbox1252846306rootsearchbox3010470100disabledstylek9cugrqc searchbox3010470100rootsearchbox3010470100disabledlilastoftype spanhorizontalmenucolumnssubmenulayout1903511735rootstylek9cugrqc searchbox3010470100rootsearchbox3010470100previewstatehoverborderbox 0 0auto0boxsizingrgba149 11 11searchbox3010470100buttoniconstylek9cugrqcopen sanssansseriftextdecorationstylek9cugrqcsearchbox1252846306root searchbox3010470100input14pxmaxwidth 50pxmaxheight 50pxwidthnormal roboto systemuisuggestion3456478798rootcolumns menu item11 11 09calc1na nica rdioimageitembackgroundimage1backgroundcolorrgba255flexwraparchetype textnselectdatapreviewhoverroboto systemuin nmetakeywordsseopagetitleseoparan cbnspanhorizontalmenucolumnssubmenulayout1903511735root horizontalmenucolumnssubmenulayout1903511735pagewrapper09horizontalmenucolumnssubmenulayout1903511735root0auto auto scrollsearchbox3010470100button searchbox3010470100buttoniconstylek9cugrqchorizontalmenucolumnssubmenulayout1903511735pagewrapperlinear backgroundimage7avoid chrome safarigrossa brasilpageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaids6eahdesktopbgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaids6eahmobilebgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitemk6s9dr0pmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsetitleurif260916921a43dd54f4c6e960b012ade8aab3amv2pngwidth2000height1500altqualityunsharpmaskradius2amount1threshold0cachemaxagehours24advancedseodatatagstypemetapropspropertyogimagecontentf260916921a43dd54f4c6e960b012ade8aab3amv2pngmetawidth2000height1500typemetapropsnamedescriptioncontentasspanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtl16pxabsolutetop25s easeout1backgroundcolorrgba255 255 255heightrgba0 0 0maxwidthborderstylesolidbordercolorrgba249 249 2490 035compkevvh4v9inheritnbreakinside avoid iergba235 229 214searchbox3010470100buttonborderwidth 1pxbordercolorboxsizinglibrestylek9cugrqcsearchbox1252846306rootsearchbox3010470100previewstatehover searchbox3010470100inputsobre980px 05ahorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtl horizontalmenu2645433724menuparannormal 16px12emheight 100width100height100backgroundrgba255 255div pgi5f7b8506f7290c0017387e6b1 imageitemhorizontalmenucolumnssubmenulayout1903511735listwrapper lilastoftype

Longtail Keyword Density for Cbnpg.com.br

KeywordsOccurences
margin-left calc100 980px23
calc100 980px 0523
open sanssans-seriftext-decoration line-heightnormalcomp-kevvh4v919
rgba0 0 018
normal normal normal15
font normal normal11
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma11
helveticaneuew02-55roma helveticaneuew10-55roma helvetica11
helveticaneuew10-55roma helvetica arial11
neue helveticaneuew01-55roma helveticaneuew02-55roma11
rgba255 255 25510
div pgi5f7b78d866115f0017e7d7862 image-item10
div pgi5f7b78d866115f0017e7d7862 image-itemcanvas10
dos campos gerais10
normal 16px12em open10
normal normal 16px12em10
open sanssans-serif color00000010
rdio all news9
16px12em open sanssans-seriftext-decoration9
repeat padding-box border-box8
normal normal 14px14em8
255 255 18
style-k9cugrqc searchbox3010470100input dropdown943170449dropdowncontent8
0 0 038
style-k9cugrqcsearchbox1252846306root searchbox3010470100input dropdown943170449dropdowncontent8
11 11 098
campos gerais na8
cbn ponta grossa8
news de ponta8
nica rdio all8
na nica rdio8
gerais na nica8
notcias dos campos8
rgba149 11 118
searchbox3010470100button-iconcolor rgba0 06
normal normal 3006
normal 300 normal6
0 0 16
searchbox3010470100input dropdown943170449dropdowncontent dropdowncontent372933412dropdownoptiondropdownoption1477900353--hovered6
0 0 2px6
n -archetype boxn6
normal 14px14em libre6
searchbox3010470100input inputwithoptions1325345868inputcomponent input1125155884nativeinputpadding-left6
width100height100backgroundrgba255 255 2555
255 255 09font-size0margin-top5px5
iframe-webkit-full-screen min-heightauto important5
color373737font-familyhelvetica neue helveticaneuew01-55roma5
03 style-k9cugrqc searchbox3010470100rootsearchbox3010470100--disabled5
style-k9cugrqcsearchbox1252846306root searchbox3010470100input inputwithoptions1325345868inputcomponent5
style-k9cugrqc searchbox3010470100rootsearchbox3010470100--disabled searchbox3010470100input5
0 03 style-k9cugrqc5
0 2px 0border-color5
1 style-k9cugrqcsearchbox1252846306root searchbox3010470100input5
helvetica arial sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter5
font-familyhelvetica neue helveticaneuew01-55roma5
helvetica arial sans-serifdisplaynone5
normal 13px12em open5
open sanssans-seriftext-decoration line-heightnormalfont-styleinheritfont-weightinherit-webkit-text-decorationinherittext-decorationinheritcomp-kevvh4v95
normal normal 13px12em5
300 normal 16px5
columns menu item4
searchbox3010470100input dropdown943170449dropdowncontent dropdowncontent372933412dropdownoptiondropdownoption1477900353--selected4
horizontalmenucolumnslayout852678809pagewrapper horizontalmenucolumnslayout852678809listwrapper lifirst-of-type4
style-k9cugrqc searchbox3010470100root suggestion3456478798root4
searchbox3010470100input inputwithoptions1325345868inputcomponent input1125155884nativeinputtext-align4
50pxmax-height 50pxwidth 09emheight4
14pxmax-width 50pxmax-height 50pxwidth4
14pxmin-height 14pxmax-width 50pxmax-height4
scroll linear-gradient180deg rgba1494
linear-gradient180deg rgba149 114
02s ease visibility4
-webkit-column-break-inside avoid chrome4
-archetype textn -controller-part-type4
n -archetype textn4
normal normal 12px12em4
normal 12px12em open4
-archetype text -controller-part-type4
text -controller-part-type layoutchilddisplaydropdown4
avoid chrome safari4
style-k9cugrqc searchbox3010470100input inputwithoptions1325345868inputcomponent4
chrome safari opera4
03 style-k9cugrqcsearchbox1252846306rootsearchbox3010470100--disabled searchbox3010470100input4
page-break-inside avoid firefox4
break-inside avoid ie4
avoid ie 104
all 02s ease4
spanhorizontalmenucolumnslayout852678809root horizontalmenucolumnslayout852678809pagewrapper horizontalmenucolumnslayout852678809listwrapper4
255 255 034
normal roboto system-ui4
11 09 1004
padding-box border-box 04
255 1 style-k9e6zm73navcontainer4
border-box 0 0auto4
1background-colorrgba255 255 2554
249 1background-colorrgba255 2554
249 249 1background-colorrgba2554
100 round repeat4
09 100 round4
border-stylesolidborder-colorrgba249 249 2494
16px normal roboto4
border-width2px border-stylesolidborder-colorrgba249 2494
0 rgba149 114
round repeat padding-box4
0 0auto auto4
09 0 rgba1494
scroll urlhttpsstaticwixstaticcommediae3bf95a9cdd441ebaf55f139b1b5a7b8pngv1fillw52h52alclg1e3bf95a9cdd441ebaf55f139b1b5a7b8pngformattervaluese3bf95a9cdd441ebaf55f139b1b5a7b8png3737 rgb1494
urlhttpsstaticwixstaticcommediae3bf95a9cdd441ebaf55f139b1b5a7b8pngv1fillw52h52alclg1e3bf95a9cdd441ebaf55f139b1b5a7b8pngformattervaluese3bf95a9cdd441ebaf55f139b1b5a7b8png3737 rgb149 114
0auto auto scroll4
horizontalmenucolumnssubmenulayout1903511735pagewrapper horizontalmenucolumnssubmenulayout1903511735listwrapper lifirst-of-type4
inset 0 04
horizontalmenucolumnssubmenulayout1903511735pagewrapper horizontalmenucolumnssubmenulayout1903511735listwrapper lilast-of-type4
spanhorizontalmenucolumnssubmenulayout1903511735root horizontalmenucolumnssubmenulayout1903511735pagewrapper horizontalmenucolumnssubmenulayout1903511735listwrapper4
11 09 04
normal 16px normal4
hiddentext-overflow ellipsis style-k9cugrqc4
0 0 04
auto scroll linear-gradient180deg4
searchbox3010470100input inputwithoptions1325345868inputcomponent input1125155884nativeinputstyle-k9cugrqc4
horizontalmenucolumnslayout852678809pagewrapper horizontalmenucolumnslayout852678809listwrapper lilast-of-type4
grossa metakeywordsseopagetitleseoparan cbn3
box display flex3
display block transition3
ponta grossa metakeywordsseopagetitleseoparan3
-archetype box display3
cursor default important3
block transition inherit3
-archetype paintbox display3
paintbox display block3
nntypetitlechildrenparan cbn ponta3
metakeywordsseopagetitleseoparan cbn ponta3
ponta grossa brasilpageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaids6eahdesktopbgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaids6eahmobilebgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitem-k6s9dr0pmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsetitleurif260916921a43dd54f4c6e960b012ade8aab3amv2pngwidth2000height1500altqualityunsharpmaskradius2amount1threshold0cachemaxagehours24advancedseodatatagstypemetapropspropertyogimagecontentf260916921a43dd54f4c6e960b012ade8aab3amv2pngmetawidth2000height1500typemetapropsnamedescriptioncontentas3
grossa brasilpageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaids6eahdesktopbgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaids6eahmobilebgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitem-k6s9dr0pmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsetitleurif260916921a43dd54f4c6e960b012ade8aab3amv2pngwidth2000height1500altqualityunsharpmaskradius2amount1threshold0cachemaxagehours24advancedseodatatagstypemetapropspropertyogimagecontentf260916921a43dd54f4c6e960b012ade8aab3amv2pngmetawidth2000height1500typemetapropsnamedescriptioncontentas notcias3
brasilpageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaids6eahdesktopbgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaids6eahmobilebgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitem-k6s9dr0pmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsetitleurif260916921a43dd54f4c6e960b012ade8aab3amv2pngwidth2000height1500altqualityunsharpmaskradius2amount1threshold0cachemaxagehours24advancedseodatatagstypemetapropspropertyogimagecontentf260916921a43dd54f4c6e960b012ade8aab3amv2pngmetawidth2000height1500typemetapropsnamedescriptioncontentas notcias dos3
ponta grossa nntypetitlechildrenparan3
grossa nntypetitlechildrenparan cbn3
div pgi5f7b8506f7290c0017387e6b1 image-itemcanvas3
n n nninfosvgtypeshapeviewbox03
n nninfosvgtypeshapeviewbox0 03
n -archetype paintboxnn3
-archetype paintboxnn display3
n cursor default3
-archetype boxn display3
n display flexn3
lifirst-of-type a n3
div pgi5f7b8506f7290c0017387e6b1 image-item3
28px12em open sanssans-seriftext-decoration3
div pgi5f7b85c09decb200187e4d360 image-item3
0 1 style-k9cugrqcsearchbox1252846306root3
1pxborder-color rgba00006 style-k9cugrqc3
style-k9cugrqc searchbox3010470100rootsearchbox3010470100--previewstatehover searchbox3010470100input3
searchbox3010470100button-iconcolor rgba0001 style-k9cugrqc3
style-k9cugrqc searchbox3010470100rootsearchbox3010470100--isexpandable searchbox3010470100input3
verticaloverflow hiddentext-overflow ellipsis3
none style-k9cugrqc searchbox3010470100root3
border-box transition inherit3
searchbox3010470100buttonfocusable1810053796--focus searchbox3010470100button-iconcolor rgba03
box-sizing border-box transition3
searchbox3010470100input inputwithoptions1325345868inputcomponentfocus-withinbackground rgba2553
inputwithoptions1325345868inputcomponentfocus-withinbackground rgba255 2553
2px 0border-color rgba2553
0border-color rgba255 2553
searchbox3010470100iconcolor rgba0 03
rgba235 229 2143
1s linear background-image3
searchbox3010470100buttonborder-width 0 03
positionstaticbox-shadow000 0 03
positionfixed importantleftauto importantz-index503
13px12em open sanssans-seriftext-decoration3
normal normal 28px12em3
normal 28px12em open3
blog-post-text-fontfontnormal normal normal3
0 0 035comp-kevvh4v93
12px12em open sanssans-seriftext-decoration3
div pgi5f7b85c09decb200187e4d360 image-itemcanvas3
image-itemcanvasopacity 1 transition3
1 transition opacity3
transition opacity 1s3
opacity 1s linear3
lilast-of-type a n3
normal normal68
0 041
searchbox3010470100input inputwithoptions1325345868inputcomponent32
open sanssans-seriftext-decoration27
980px 0523
calc100 980px23
margin-left calc10023
div pgi5f7b78d866115f0017e7d786222
255 25521
style-k9cugrqcsearchbox1252846306root searchbox3010470100input20
searchbox3010470100input dropdown943170449dropdowncontent20
n -archetype19
style-k9cugrqc searchbox3010470100input19
sanssans-seriftext-decoration line-heightnormalcomp-kevvh4v919
rgba0 018
ponta grossa17
0 style-k9cugrqc14
none style-k9cugrqc14
style-k9cugrqc searchbox3010470100root12
neue helveticaneuew01-55roma11
helveticaneuew01-55roma helveticaneuew02-55roma11
display flex11
open sanssans-serif11
helveticaneuew02-55roma helveticaneuew10-55roma11
helveticaneuew10-55roma helvetica11
helvetica arial11
rgba255 25511
font normal11
0 important10
pgi5f7b78d866115f0017e7d7862 image-item10
dos campos10
pgi5f7b78d866115f0017e7d7862 image-itemcanvas10
campos gerais10
normal 16px12em10
sanssans-serif color00000010
16px12em open10
rdio all9
all news9
cbn ponta9
overflow hidden9
transition inherit9
box-sizing border-box9
horizontalmenu2645433724menu lifirst-of-type8
horizontalmenucolumnssubmenulayout1903511735pagewrapper horizontalmenucolumnssubmenulayout1903511735listwrapper8
horizontalmenu2645433724menu lilast-of-type8
style-k9cugrqc searchbox3010470100rootsearchbox3010470100--disabled8
horizontalmenucolumnslayout852678809pagewrapper horizontalmenucolumnslayout852678809listwrapper8
0 038
-controller-part-type layoutchilddisplaydropdown8
gerais na8
ul lilast-of-type8
0 importantn8
div pgi5f7b8506f7290c0017387e6b18
notcias dos8
na nica8
nica rdio8
repeat padding-box8
ul lifirst-of-type8
display flexn8
rgba149 118
11 118
11 098
normal 14px14em8
div pgi5f7b85c09decb200187e4d3608
255 18
padding-box border-box8
height 1007
margin0line-heightnormalletter-spacingnormal txtnew7
1 style-k9cugrqcsearchbox1252846306root7
searchbox3010470100input popover649285268popoverelementstyle-k9cugrqc7
none style-k9cugrqcsearchbox1252846306root7
searchbox3010470100rootsearchbox3010470100--disabled searchbox3010470100input7
rgba0001 style-k9cugrqc6
searchbox3010470100button-iconcolor rgba06
-archetype boxn6
-archetype box6
0 16
cursor default6
transparent transparent6
14px14em libre6
0 2px6
normal 3006
03 style-k9cugrqc6
dropdown943170449dropdowncontent dropdowncontent372933412dropdownoptiondropdownoption1477900353--hovered6
menu item6
inputwithoptions1325345868inputcomponent input1125155884nativeinputpadding-left6
300 normal6
normal 16px5
arial sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter5
sanssans-seriftext-decoration line-heightnormalfont-styleinheritfont-weightinherit-webkit-text-decorationinherittext-decorationinheritcomp-kevvh4v95
normal 13px12em5
-archetype text5
iframe positionabsolutewidth100height100overflowhidden5
iframe-webkit-full-screen min-heightauto5
style-k9cugrqc searchbox3010470100rootsearchbox3010470100--previewstatehover5
min-heightauto important5
width100height100backgroundrgba255 2555
255 09font-size0margin-top5px5
color373737font-familyhelvetica neue5
03 style-k9cugrqcsearchbox1252846306rootsearchbox3010470100--disabled5
n height5
style-k9cugrqcsearchbox1252846306rootsearchbox3010470100--disabled searchbox3010470100input5
font-familyhelvetica neue5
hiddentext-overflow ellipsis5
13px12em open5
overflow hiddenn5
arial sans-serifdisplaynone5
style-k9cugrqc searchbox3010470100rootsearchbox3010470100--isexpandable5
5px style-k9cugrqc5
1 style-k9cugrqc5
2px 0border-color5
style-k9cugrqc searchbox3010470100rootsearchbox3010470100--previewstatefocus5
0 style-k9cugrqcsearchbox1252846306root5
n display5
100 style-k9cugrqc5
verticaloverflow hiddentext-overflow5
1 style-k9e6zm73navcontainer5
box-sizing border-boxn5
margin-bottom unset5
max-width 1005
border-color transparent5
margin-top unset5
25s ease-out4
inputwithoptions1325345868inputcomponent input1125155884nativeinputtext-align4
normal 12px12em4
12px12em open4
pgsclkevvh4v90-160 div4
lifirst-of-type spanhorizontalmenucolumnslayout852678809root4
searchbox3010470100input inputwithoptions1325345868inputcomponentfocus-withinbackground4
searchbox3010470100buttonfocusable1810053796--focus searchbox3010470100button-iconcolor4
color ffffff4
background-color ffffff4
flexalign-items centerbox-sizing4
spanhorizontalmenucolumnslayout852678809root horizontalmenucolumnslayout852678809pagewrapper4
ahorizontalmenucolumnslayout852678809root ul4
border-stylesolidborder-colorrgba249 2494
spanhorizontalmenucolumnslayout852678809root ul4
horizontalmenucolumnslayout852678809listwrapper lifirst-of-type4
unset important4
horizontalmenucolumnslayout852678809listwrapper lilast-of-type4
50pxwidth 09emheight4
50pxmax-height 50pxwidth4
14pxmax-width 50pxmax-height4
8px 04
14pxmin-height 14pxmax-width4
rgba00006 style-k9cugrqc4
lilast-of-type spanhorizontalmenucolumnslayout852678809root4
dropdown943170449dropdowncontent dropdowncontent372933412dropdownoptiondropdownoption1477900353--selected4
searchbox3010470100root suggestionheader1593519615root4
searchbox3010470100root suggestion3456478798root4
all 02s4
do trabalhador4
avoid firefox4
break-inside avoid4
avoid ie4
ie 104
textn -controller-part-type4
-archetype textn4
width 1004
style-k9cugrqcsearchbox1252846306root suggestion3456478798root4
pgsclkevvh4v9-1280-0 div4
1 style-k9cugrqcsearchbox1252846306rootsearchbox3010470100--previewstatefocus4
02s ease4
roboto system-ui4
ease visibility4
height 04
chrome safari4
box-shadow none4
255 034
border-bottom-width 04
border-top-width 04
searchbox3010470100rootsearchbox3010470100--disabled searchbox3010470100button4
padding-top 04
padding-bottom 04
margin 04
columns menu4
horizontalmenu2645433724menu li4
border-width2px border-stylesolidborder-colorrgba2494
normal roboto4
round repeat4
5px 5px4
auto scroll4
scroll linear-gradient180deg4
linear-gradient180deg rgba1494
09 04
page-break-inside avoid4
height 100n4
09 1004
100 round4
scroll urlhttpsstaticwixstaticcommediae3bf95a9cdd441ebaf55f139b1b5a7b8pngv1fillw52h52alclg1e3bf95a9cdd441ebaf55f139b1b5a7b8pngformattervaluese3bf95a9cdd441ebaf55f139b1b5a7b8png37374
0 0auto4
urlhttpsstaticwixstaticcommediae3bf95a9cdd441ebaf55f139b1b5a7b8pngv1fillw52h52alclg1e3bf95a9cdd441ebaf55f139b1b5a7b8pngformattervaluese3bf95a9cdd441ebaf55f139b1b5a7b8png3737 rgb1494
rgb149 114
n cursor4
229 2294
txtnew ul4
text -controller-part-type4
-webkit-column-break-inside avoid4
1background-colorrgba255 2554
249 1background-colorrgba2554
249 2494
0auto auto4
0 rgba1494
border-box 04
horizontalmenucolumnssubmenulayout1903511735listwrapper lilast-of-type4
16px normal4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-ltr horizontalmenu2645433724menu4
ahorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl horizontalmenu2645433724menu4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl horizontalmenu2645433724menu4
inputwithoptions1325345868inputcomponent input1125155884nativeinputstyle-k9cugrqc4
horizontalmenucolumnssubmenulayout1903511735listwrapper lifirst-of-type4
display block4
searchbox3010470100input inputwithoptions1325345868inputcomponentz-index4
spanhorizontalmenucolumnssubmenulayout1903511735root horizontalmenucolumnssubmenulayout1903511735pagewrapper4
ahorizontalmenucolumnssubmenulayout1903511735root ul4
spanhorizontalmenucolumnssubmenulayout1903511735root ul4
ellipsis style-k9cugrqc4
lifirst-of-type spanhorizontalmenucolumnssubmenulayout1903511735root4
lilast-of-type spanhorizontalmenucolumnssubmenulayout1903511735root4
inset 04
avoid chrome4
default style-k9cugrqc4
safari opera4
12px style-k9cugrqc4
nninfosvgtypeshapeviewbox0 03
pgi5f7b8506f7290c0017387e6b1 image-item3
brasilpageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaids6eahdesktopbgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaids6eahmobilebgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitem-k6s9dr0pmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsetitleurif260916921a43dd54f4c6e960b012ade8aab3amv2pngwidth2000height1500altqualityunsharpmaskradius2amount1threshold0cachemaxagehours24advancedseodatatagstypemetapropspropertyogimagecontentf260916921a43dd54f4c6e960b012ade8aab3amv2pngmetawidth2000height1500typemetapropsnamedescriptioncontentas notcias3
grossa nntypetitlechildrenparan3
pgi5f7b85c09decb200187e4d360 image-itemcanvas3
n margin-top3
pgi5f7b85c09decb200187e4d360 image-item3
-archetype paintboxnn3
n width3
nntypetitlechildrenparan cbn3
paintboxnn display3
metakeywordsseopagetitleseoparan cbn3
linear background-image3
pgi5f7b8506f7290c0017387e6b1 image-itemcanvas3
n nninfosvgtypeshapeviewbox03
image-itemcanvasopacity 13
width 100n3
n n3
boxn display3
transition opacity3
opacity 1s3
n flex-grow3
1s linear3
grossa brasilpageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaids6eahdesktopbgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaids6eahmobilebgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitem-k6s9dr0pmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsetitleurif260916921a43dd54f4c6e960b012ade8aab3amv2pngwidth2000height1500altqualityunsharpmaskradius2amount1threshold0cachemaxagehours24advancedseodatatagstypemetapropspropertyogimagecontentf260916921a43dd54f4c6e960b012ade8aab3amv2pngmetawidth2000height1500typemetapropsnamedescriptioncontentas3
grossa metakeywordsseopagetitleseoparan3
transition inheritn3
1 transition3
14px style-k9cugrqc3
blog-link-hover-colorhovercolorf2ad2ecomp-kevvh4v9 is-desktop3
none important3
transparent black3
popover649285268arrowborder-width 5px3
04s ease3
selectdata-previewerror style-k9e6zm73navcontainerarrow3
style-k9e6zm73navcontainerarrow style-k9e6zm73navcontainersvgcontainer3
204 2043
ol ul3
ultxtnew ol3
positionstaticbox-shadow000 03
importantleftauto importantz-index503
positionfixed importantleftauto3
border-box transition3
transparent style-k9cugrqc3
pointer-events none3
align-items center3
-archetype paddingbox3
box display3
flex-grow inherit3
default important3
block transition3
paintbox display3
-archetype paintbox3
background-color 6c3c173
color 6c3c173
14px12em open3
black transparent3
pointer style-k9cugrqc3
blog-hover-container-element-colorcolorf2ad2ecomp-kevvh4v9 is-desktop3
inputwithoptions1325345868inputcomponentfocus-withinbackground rgba2553
0 035comp-kevvh4v93
blog-post-text-fontfontnormal normal3
28px12em open3
normal 28px12em3
searchbox3010470100buttonborder-width 03
229 2143
rgba235 2293
style-k9cugrqcsearchbox1252846306rootsearchbox3010470100--previewstatehover searchbox3010470100input3
searchbox3010470100iconcolor rgba03
0border-color rgba2553
style-k9cugrqcsearchbox1252846306root searchbox3010470100inputdropdown943170449--content-visible3
style-k9cugrqcsearchbox1252846306rootsearchbox3010470100--isexpandable searchbox3010470100input3
searchbox3010470100iconstyle-k9cugrqc searchbox3010470100rootsearchbox3010470100--disabled3
position absolutetop3
searchbox3010470100buttonborder-width 1pxborder-color3
searchbox3010470100input inputwithoptions1325345868inputcomponentstyle-k9cugrqc3
searchbox3010470100button-iconcolor rgba00013
searchbox3010470100button searchbox3010470100button-iconstyle-k9cugrqc3
searchbox3010470100button buttonnext3654178621contentstyle-k9cugrqc3
searchbox3010470100rootsearchbox3010470100--previewstatehover searchbox3010470100input3
var--searchbox3010470100-icon-spacing style-k9cugrqc3
1pxborder-color rgba000063
style-k9cugrqc searchbox3010470100inputdropdown943170449--content-visible3
searchbox3010470100rootsearchbox3010470100--isexpandable searchbox3010470100input3
style-k9cugrqc suggestion3456478798rootsuggestion3456478798--mobileview3
center style-k9cugrqc3
horizontalmenu2645433724menu n3
style-k9cugrqc172
0154
normal132
searchbox3010470100input106
n68
style-k9cugrqcsearchbox1252846306root46
145
color40
div40
none39
open38
-archetype38
background-color36
important34
display33
inputwithoptions1325345868inputcomponent33
230
329
sanssans-seriftext-decoration27
horizontalmenu2645433724menu27
height26
ul26
transition26
is-desktop26
margin-left25
lifirst-of-type24
lilast-of-type24
searchbox3010470100button24
980px23
calc10023
0523
pgi5f7b78d866115f0017e7d786223
inherit22
line-heightnormalcomp-kevvh4v921
dropdown943170449dropdowncontent21
searchbox3010470100rootsearchbox3010470100--disabled20
420
transparent20
grossa19
ponta19
rgba018
overflow18
txtnew18
border-box18
box-sizing18
image-itemcanvas16
image-item16
width16
searchbox3010470100root16
positionabsolutetop0right0bottom0left015
flex15
5px15
unset15
0314
all14
auto14
na14
displaynone13
style-k9e6zm73navcontainer13
-controller-part-type12
default12
avoid12
importantn12
hidden12
helvetica11
arial11
style-k9e6zm73navcontainerarrow11
neue11
511
helveticaneuew10-55roma11
helveticaneuew01-55roma11
color00000011
sanssans-serif11
helveticaneuew02-55roma11
font11
rgba25511
16px12em10
suggestionheader1593519615root10
0910
searchbox3010470100button-iconcolor10
cbn10
rdio10
positionabsolutetop0left0color373737width100height10010
ffffff10
center10
100height10
cursor10
dos10
max-width10
campos10
gerais10
horizontalmenucolumnssubmenulayout1903511735listwrapper9
pgi5f7b85c09decb200187e4d3609
position9
pgi5f7b8506f7290c0017387e6b19
news9
scroll9
100n9
notcias9
horizontalmenucolumnssubmenulayout1903511735pagewrapper9
horizontalmenucolumnslayout852678809pagewrapper9
horizontalmenucolumnslayout852678809listwrapper9
inheritn9
spanhorizontalmenucolumnssubmenulayout1903511735root8
nica8
suggestion3456478798root8
popover649285268popoverelementstyle-k9cugrqc8
repeat8
padding-box8
flex-grow8
layoutchilddisplaydropdown8
hiddentext-overflow8
flexn8
item8
68
14px14em8
rgba1498
min-width8
style-k9cugrqcsearchbox1252846306rootsearchbox3010470100--disabled8
spanhorizontalmenucolumnslayout852678809root8
searchbox3010470100inputdropdown943170449--content-visible8
8px8
pointer-events8
margin0line-heightnormalletter-spacingnormal7
overflowhidden7
12px7
flexalign-items7
ol7
16px7
0border-color7
var7
ellipsis7
0000007
ease7
pointer6
text-overflow6
dropdowncontent372933412dropdownoptiondropdownoption1477900353--hovered6
76
blog-post-homepage-post-container6
blog-post-category-post-container6
style-k9e6zm73navcontainerarrowstyle-k9e6zm73navcontainerleft-direction6
blog-post-post-list-post-container6
visibility6
searchbox3010470100buttonborder-width6
white-space6
align-items6
style-k9e6zm73navcontainerarrowstyle-k9e6zm73navcontainerright-direction6
do6
style-k9e6zm73navcontainerarrowstyle-k9e6zm73navcontainercenter-direction6
boxn6
box6
hiddenn6
6c3c176
0n6
justify-content6
menu6
box-shadow6
margin-top6
searchbox3010470100rootsearchbox3010470100--previewstatefocus6
rgba00016
searchbox3010470100rootsearchbox3010470100--previewstatehover6
var--searchbox3010470100-icon-spacing6
searchbox3010470100iconcolor6
libre6
border-color6
2px6
margin-bottom6
input1125155884nativeinputpadding-left6
padding-top6
86
searchbox3010470100button-iconstyle-k9cugrqc6
columns6
margin6
padding-bottom6
style-k9cugrqcsearchbox1252846306rootsearchbox3010470100--previewstatehover5
color0099fftext-decorationunderlinecursorpointer5
border-boxn5
searchbox3010470100rootsearchbox3010470100--isexpandable5
searchbox3010470100iconstyle-k9cugrqc5
style-k9cugrqcsearchbox1252846306rootsearchbox3010470100--isexpandable5
sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter5
displayinline-block5
opacity15
font-familyhelvetica5
sans-serifdisplaynone5
style-k9cugrqcsearchbox1252846306rootsearchbox3010470100--previewstatefocus5
1pxborder-color5
verticaloverflow5
opacity5
0right5
-webkit-box-webkit-line-clamp5
line-heightnormalfont-styleinheritfont-weightinherit-webkit-text-decorationinherittext-decorationinheritcomp-kevvh4v95
width100height100backgroundrgba2555
color373737font-familyhelvetica5
ultxtnew5
13px12em5
block5
text5
95
1px5
svg5
10px5
0px5
black5
left5
li5
09font-size0margin-top5px5
1s5
unsetn5
min-heightauto5
if5
iframe-webkit-full-screen5
width100height1005
iframe5
positionabsolutewidth100height100overflowhidden5
ahorizontalmenucolumnssubmenulayout1903511735root4
flex-wrap4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-ltr4
ahorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl4
suggestionfooter2422147164root4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl4
popover649285268arrowborder-width4
0left4
suggestionheader1593519615rootbackground4
dropdowncontent372933412dropdownoptiondropdownoption1477900353--selected4
padding-right4
inset4
searchbox3010470100buttonstyle-k9cugrqc4
pgsclkevvh4v9-1280-04
opera4
searchbox3010470100buttonfocusable1810053796--focus4
searchbox3010470100buttonhover4
0auto4
linear-gradient180deg4
input1125155884nativeinputtext-align4
searchbox3010470100inputfocus-within4
round4
inputwithoptions1325345868inputcomponentfocus-withinbackground4
submenu4
page-break-inside4
top4
blog-link-hashtag-colorcolorf2ad2ecomp-kevvh4v94
blog-icon-fillfill000000comp-kevvh4v94
padding4
style-k9e6zm73repeaterbuttonlabel4
lb1itemscontainer4
blog-link-hover-colorhovercolorf2ad2ecomp-kevvh4v94
02s4
border4
relative4
casos4
ahorizontalmenucolumnslayout852678809root4
fff4
nesta4
border-bottom-width4
border-top-width4
trabalhador4
ie4
break-inside4
firefox4
searchbox3010470100inputhover4
blog-hover-container-element-colorcolorf2ad2ecomp-kevvh4v94
urlhttpsstaticwixstaticcommediae3bf95a9cdd441ebaf55f139b1b5a7b8pngv1fillw52h52alclg1e3bf95a9cdd441ebaf55f139b1b5a7b8pngformattervaluese3bf95a9cdd441ebaf55f139b1b5a7b8png37374
rgb1494
1background-colorrgba2554
system-ui4
pgsclkevvh4v90-1604
input1125155884nativeinputstyle-k9cugrqc4
4px4
inputwithoptions1325345868inputcomponentz-index4
border-width2px4
border-stylesolidborder-colorrgba2494
rua4
border-boxwidth4
number4
suggestion3456478798contentmargin-left4
textn4
centern4
auton4
12px12em4
nonen4
absolutetop4
searchbox3010470100inputcontainerwidth4
roboto4
centerbox-sizing4
chrome4
safari4
09emheight4
50pxwidth4
50pxmax-height4
14pxmax-width4
14pxmin-height4
noneborder4
rgba000064
solidborder-width4
blog-hover-container-element-fillfillf2ad2ecomp-kevvh4v94
-webkit-column-break-inside4
ease-out4
25s4
calc-14
nntypetitlechildrenparan3
bold3
14px12em3
nowrapn3
blog-post-text-colorcolor000000comp-kevvh4v93
metakeywordsseopagetitleseoparan3
linear3
brasilpageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaids6eahdesktopbgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaids6eahmobilebgmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsecolorcolor11aligntypecenterfittingtypefillscrolltypescrollcoloroverlaycoloroverlayopacity0ispresettruemediasizingviewporttranslationdatauriseotranslatedfalseogimagereftypeimageiddataitem-k6s9dr0pmetadatapageids6eahispresetfalseschemaversion20ishiddenfalsetitleurif260916921a43dd54f4c6e960b012ade8aab3amv2pngwidth2000height1500altqualityunsharpmaskradius2amount1threshold0cachemaxagehours24advancedseodatatagstypemetapropspropertyogimagecontentf260916921a43dd54f4c6e960b012ade8aab3amv2pngmetawidth2000height1500typemetapropsnamedescriptioncontentas3
paintbox3
blog-link-hover-fillhoverfillf2ad2ecomp-kevvh4v93
image-itembackground-image3
image-itemcanvasopacity3
e3
horizontalmenuitem1808041630container3
horizontalmenuitem1808041630label3
paddingbox3
paintboxnn3
paran3
nninfosvgtypeshapeviewbox03
sobre3
background-image3
horizontalmenusubitem329750698label3
style-k9e6zm73navcontainerright-direction3
04s3
style-k9e6zm73navcontainersvgcontainer3
positionstaticbox-shadow0003
oldirrtl3
visible3
searchbox3010470100rootsearchbox3010470100--withoverridefontsize3
strc1inlinecontent3
strc1data-responsive3
063
border-radius03
suggestion3456478798rootsuggestion3456478798--mobileview3
suggestion3456478798thumbnailwidth3
style-k9e6zm73navcontainerleft-direction3
topautobottom03
0width3
selecthover3
selectdata-previewhover3
dropdowncontent372933412dropdownoption3
selectfocus3
selectdata-previewfocus3
0bottom3
selectdata-errortrue3
selectdata-previewerror3
14px3
20px3
0border-radius3
importantz-index503
035comp-kevvh4v93
style-kcdqwz4h3
blog-post-text-fontfontnormal3
28px12em3
0s3
no3
nowrap3
da3
style-k9e6zm73navcontainercenter-direction3
para3
comp-kevvh4v93
horizontalmenucolumnslayout852678809root3
searchbox3010470100iconstyle-k9cugrqcsearchbox1252846306rootsearchbox3010470100--disabled3
importantleftauto3
horizontalmenucolumnslayout852678809menuitem3
103
rgba2353
0box-sizing3
solidborder-color3
searchbox3010470100button-iconstyle-k9cugrqcsearchbox1252846306root3
horizontalmenucolumnssubmenulayout1903511735root3
stylablehorizontalmenu4089050981menuitem3
inputwithoptions1325345868inputcomponentstyle-k9cugrqc3
buttonnext3654178621contentstyle-k9cugrqc3
positionfixed3
horizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scroll3

Cbnpg.com.br Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Cbnpg.com.br is a scam?

Websites with Similar Names

Cbnpg.com.br
Paraná | CBN Ponta Grossa | Brasil

Recently Updated Websites

Businessvacuum.com 4 seconds ago.Bdhomes.com 4 seconds ago.Diffuzehosting.com 5 seconds ago.Lankarahas.com 5 seconds ago.Wanzehui.com 5 seconds ago.Mexicata.com 6 seconds ago.Koromaru.com 6 seconds ago.Masky.ru 7 seconds ago.Audiv8.com 7 seconds ago.Abesystems.com 7 seconds ago.Womantop.ru 7 seconds ago.Sabioappscan.us 8 seconds ago.Shine-kote.com 8 seconds ago.Greatquotationsinc.com 8 seconds ago.Microtechmobile.net 9 seconds ago.Dealsdaily.pk 9 seconds ago.Ukmgt.com 9 seconds ago.Tseegan.com 10 seconds ago.Gamengin.com 10 seconds ago.Surbo.net 10 seconds ago.Francoiseolivas.com 10 seconds ago.Mariaplusasiri.com 11 seconds ago.Rainbowroofingmaster.com 11 seconds ago.Grandviewny.net 12 seconds ago.Servals.in 12 seconds ago.Berda.com 12 seconds ago.Dsaokc.org 13 seconds ago.Basilius-besler.com 13 seconds ago.Beaversbendmarina.com 14 seconds ago.Battery-anime.com 14 seconds ago.