Coeur d‘Alene Public Schools / Homepage

Safety: Low trust score
Year Founded: 2003
Global Traffic Rank: 374,609
Estimated Worth: $1,440



Domain summary

Last updated
2020-10-18
Domain label
cdaschools
Domain extension
org
Domain registered:
2003-03-21
Domain updated:
2020-10-18
Global Traffic Rank
374,609
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$1,440
Estimated daily income
$6
Estimated monthly income
$183

Rank summary

How is cdaschools.org ranked relative to other sites:

Percentage of visits to cdaschools.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Cdaschools.org registered?
A: Cdaschools.org was registered 18 years, 3 weeks, 6 days, 5 hours, 17 minutes, 17 seconds ago on Friday, March 21, 2003.
Q: When was the WHOIS for Cdaschools.org last updated?
A: The WHOIS entry was last updated 5 months, 4 weeks, 2 days, 5 hours, 17 minutes, 17 seconds ago on Sunday, October 18, 2020.
Q: What are Cdaschools.org's nameservers?
A: DNS for Cdaschools.org is provided by the following nameservers:
  • ns1.nwednet.com
  • ns2.nwednet.com
Q: Who is the registrar for the Cdaschools.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Cdaschools.org?
A: Cdaschools.org ranks 374,609 globally on Alexa. Cdaschools.org has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Cdaschools.org each day?
A: Cdaschools.org receives approximately 994 visitors and 1,988 page impressions per day.
Q: What IP address does Cdaschools.org resolve to?
A: Cdaschools.org resolves to the IPv4 address 52.206.191.232.
Q: In what country are Cdaschools.org servers located in?
A: Cdaschools.org has servers located in the United States.
Q: What webserver software does Cdaschools.org use?
A: Cdaschools.org is powered by Awselb/2.0 webserver.
Q: Who hosts Cdaschools.org?
A: Cdaschools.org is hosted by Amazon.com, Inc. in Virginia, Ashburn, United States, 20149.
Q: How much is Cdaschools.org worth?
A: Cdaschools.org has an estimated worth of $1,440. An average daily income of approximately $6, which is roughly $183 per month.

Cdaschools.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Cdaschools.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Cdaschools.org

H1 Headings

24 :
  1. COEUR d’ALENE PUBLIC SCHOOLS
  2. Announcements
  3. Monthly Calendar:
  4. Monday
  5. Wednesday
  6. October 28, 2020
  7. October 29, 2020
  8. October 31, 2020
  9. November 2, 2020
  10. District Newsletter
  11. What's New
  12. The Sup is On/Weekly Podcast
  13. Policy & Procedure Up for Public Review
  14. Local Family Assistance
  15. Watch School Board Meetings via LIVE STREAM
  16. Adopt a Classroom Program
  17. District Tip Line:
  18. Donate
  19. Office Hours:
  20. Facebook Posts
  21. Social Media @cdaschools
  22. School Flyers
  23. Find it Fast:
  24. Mobile App

H2 Headings

3 :
  1. Get In Touch
  2. Visit Us
  3. Helpful Links

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

22 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-5173826-6

Links - Internal

235:

Links - Internal (nofollow)

0:

Links - Outbound

22:

Links - Outbound (nofollow)

0:

Keyword Cloud for Cdaschools.org

27 escape keymake sureclickingiftargetviewactivechannelnavtypeetargetblur etargetclasslistremovefocusopenpagesubmenuthisparentreviewtrimsublisthtml sublistattrariahidden trueattrariaexpandeddata success failurecontainer 2octoberelse if ekeycodealertboxid oklengthtaglistdalenefunction loadtaggeddatacontainer miiddialog if dialogoverlaywindowlargemodalbodymoderatecontentlengthtaglist lidocumentreadyfunction varestopimmediatepropagation epreventdefaultpmiuidialogoverlaybasemodalepreventdefault get idnewsletterif ekeycode 27getcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid pagemoduleinstanceidif swalertopenalertboxid okclickgroupby tag viewtouseresourceskey estopimmediatepropagation epreventdefaulthiddendoesnt bleedalertboxid noclickuiswalertlengthschool boardtag viewtouse looksok or noopenlinkinnewwindow truecontent doesnt bleeduidialogoverlayclosemodalvisiblelastclick elsebleed throughif trimsublisthtml sublistattrariahiddencoeur daleneviewtouse ifhidmiidsidebarlistviewlengthvar data varchksidebar settimeoutfunctiontargetviewelse remove focusopenlinkinnewwindowclick here1 varswalertopen uiswalertlength ifmiddle schoolviewtouse tagfailurepagemoduleinstanceidpmi renderloc0fromrenderloc0tagactiveselectorid aattrhrefvar domainid 4uiswalertattridremove focus etargetblurraisedbydatepicker estopimmediatepropagation epreventdefaultiftargetview undefinedfindswalertopen 1renderloc0fromrenderloc0groupyear groupyear groupmonthmiid pagemoduleinstanceidvar pageiddonatecommentstagfunction ifalertboxidsubhidden sidebar listbuttonproplinkhref0 alertboxid okclick0 targetviewclose dialog uidialogoverlayclosemodalvisiblelastclickvar swalertopen uiswalertlengthdialog uidialogoverlayclosemodalvisiblelastclick elsegroupby renderloc0fromrenderloc0enablequirksmode0tag7true videolinktextimageheight 487 imagealttextreopening planpublic schoolsmodulecontent miidfinduiwidgetdetailfinduiarticleappendnbspbleedvar viewtousemiid pmi flexdataidthisclickfunction esublistthisremoveclasshovere varpageidgroupmonth10else ifvideoiframehigh schoolthischildrenulvar alertboxid uiswalertattriddomainid 4listalreadyli akeypressfunctione ifewhichvideoiframe flexdataiddocumentreadyfunction taglistdatepicker varcomments 1no if alertboxidetargetclasslistremovefocus documentreadyfunctionfalse caption imagesrcifhidmiidsidebarlistviewlength 00 ifhidden detailaddloaddatacontainerinfotrueattrariaexpandedlooksdocumentreadyfunctionviewid targetview containerifewhichlidatabcsid activeselectoridplantargetview lookstargetview tag iftargetviewopen alertcontaineroklength 0 alertboxidpage2 chksidebaruidialogoverlaypmi renderloc0fromrenderloc0groupyearmiid pmi tagcloseviewid targetviewthischildrenul if trimsublisthtmlgetgroupyear groupmonth groupbyeventdateidenablequirksmode0viewid viewtousebuilderhidecaptionswgotosearchresultspageswsearchinputloadgroupeddatacontainer miidpageid 1viewtouse hidvideoisembedded falsemodulecontent miid findtabindexfirstfocuslist viewuiswalertlength if swalertopenviewuidialogoverlayclosemodalvisiblelastclick else remove3usmodulecontent miidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunctionfocus etargetblurmake sure moderated11if dialogoverlaywindowlargemodalbodymoderatecontentlengthgroupmonth groupby targetview0 modulecontentswalertopen uiswalertlengthdialog ifdetailid of openif raisedbydatepickerpmi flexdataid flexdataiduserregidvideolinktext videoisembeddedrenderloc0fromrenderloc0enablequirksmode0tagthischildrenul iflinktext click herepmi groupyearfindtabindexfirstfocus 200findtabindexfirstfocus2 chksidebar functionvarswalertopenview targetviewif trimsublisthtmlhrefimagealttextmedia maxwidthtargetview container 2var viewtouse ifhidmiidsidebarlistviewlengthsublistattrariahidden trueattrariaexpanded falseclickpmi renderloc0fromrenderloc0tag tagpagenavigationstatecookie functionblackboardtag enablequirksmode0viewidviewtousevar failureviewtouse tag tagourcdachksidebar settimeoutfunction modulecontent0 modulecontent miidfinduiwidgetdetailfinduiarticleappendnbspgroupbyfield groupbygroupbyfield groupby renderloc0fromrenderloc0enablequirksmode0tagflexdataid groupyear groupyearcoeuruiswalertlength ifclick oknoclickpmi groupyear groupmonthalertvar sublist thischildrenul0updatescheck if esce var swalertopentitleactivefocus etargetblur etargetclasslistremovefocusclose dialogislinked true linkurlpolicy updatesspecial9nbspvar swalertopenmodulecontent miiddefineduiswalertsidebar listdialogtargetview tagtag iftargetviewgroupyear groupmonthakeypressfunctionerisk leveldetail view definedpmokclick elseraisedbydatepickeruidialogoverlaybasemodal uidialogoverlay uiswalertdocumentreadyfunction var domainidiseditgroupyear groupyeargroupbyfieldbodyonkeydown uidialogoverlaybasemodalchksidebar function loaddatacontainerchannel200 documentreadyfunction varview definedbuilder view targetviewchksidebar functionsuccessloadgroupeddatacontainerhid miid sidebarlistviewvalwindowlocationassistance13 thisclicklevelgroupmonth groupmonth groupbyfieldzindex1targetview hidmiiddetailviewvalepreventdefault getislinked trueflexdataid flexdataidefunction loaddatacontainer miiduluibreadcrumbsdata successpmi renderloc0fromrenderloc0groupyear groupyear12etargetclasslistcontainsdatepicker ifaattrtargetkeyrenderloc0fromrenderloc0groupyearalertboxid uiswalertattridviewtouse hid miidimageheightget id0 targetview looksbodyonkeydown uidialogoverlaybasemodal uidialogoverlaydialogoverlaywindowlargemodalbodymoderatecontentlength 05miid pmihereescwebsitepmi flexdataid groupyearidremovewednesdayelse removedivswspecialmodebarfunction loaddatacontainerimagesrcvar successelseparentzindextag containerpmi22709before contentmaxwidthpageid 1 varsidebarlistviewvaluidialogoverlay uiswalertimagewidth 945hidetitle truedata var successflexdataidlicollapsibleeachfunctionrenderloc0fromrenderloc0enablequirksmode0tag tag viewidfamilyifhidmiidsidebarlistviewlength 0 viewtousehighmoderatedopenfalsecheckscriptmoduleviewcheckscriptmustacheoptionsopen alert varsidebarokgroupyear groupyear groupmonthoklength 0var pageid 1hidpmi tag viewtousecheck to makeestopimmediatepropagationno ififdistrict officeepreventdefault checkcallcontrollerfailureresult0errormessagetargetviewlength945 imageheight 487var domainidif ekeycode13noimagewidth 945 imageheighthomeappreopeningraisedbydatepicker etargetclasslistcontainsdatepicker ifvar raisedbydatepicker etargetclasslistcontainsdatepickergroupmonth groupmonthalert varsure moderated contentsure moderatedraisedbydatepicker estopimmediatepropagationenddoesntmagnettrueattrariaexpanded falseetargetblurremove focusactiveselectoridactive classgroupby tagall945 imageheightthisremoveclasshover varpagenavigationstatecookiepmi tagcheckalertboxid uiswalertattrid clickhidetitlerenderloc 0 varsublist thischildrenulmodulecontentskipchksidebar function loadtaggeddatacontainergroupby enablequirksmode0viewidmiidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunction checkscriptmoduleviewcheckscriptmustacheclassekeycodelinkurlgetcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miidactiveselectorid aattrtargetloadtaggeddatacontainer miidvideolinktext videoisembedded falsemiidfinduiwidgetdetailfinduiarticleappendnbspvar miidchevronmeetingsescape keysidebarlistviewval getcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidetargetblur etargetclasslistremovefocus documentreadyfunctiontrimsublisthtmlsitenavulheightrenderloc0fromrenderloc0tag tag enablequirksmode0viewidviewtousenavsepreventdefault4 var pageidnoclick else ifokclick else alertboxidsublist thischildrenul ifgroupbyfield groupby enablequirksmode0viewidsection1 ifsettimeoutfunction modulecontent miidloaddatacontainer miidpressedfalse videoiframe flexdataiddetail viewmiidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunctionboardalert var alertboxidetargetclasslistremovefocusstartpagemoduleinstanceid pmi renderloc0fromrenderloc0tagrenderloc0fromrenderloc0tagsitepagemoduleinstanceid pmi renderloc0fromrenderloc0groupyearepreventdefault close dialogbuilder viewuidialogoverlaybasemodal uidialogoverlayenablequirksmode0viewidviewtouse containerdistrictthisclick functionloadtaggeddatacontainer miid pmimiid pagemoduleinstanceid pmidata varif alertboxidviewidtargetviewlength 0captiongroupby targetview tagthroughdocumentonmouseoutfamiliesfindtabindexfirstfocus 200 documentreadyfunctionmakedatepicker var raisedbydatepickereverypagemoduleinstanceid pmi flexdataid0 alertboxidgroupby enablequirksmode0viewid viewtousetargetview hidmiiddetailviewval getcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidlinktext clicktargetviewlength 0 targetviewmoderated contentamdatavar renderloc 0ekeycode 27 escape4 varpublicapimagnet schoolif swalertopen 1epreventdefault check ifalertboxid noclick elsepmi flexdataiddocumentonmouseoverrenderloc 0meetingcontainer 2 chksidebarcentertag iftargetview undefinedvar raisedbydatepickerviewtouse ifhidmiidsidebarlistviewlength 0yourundefined targetviewlength 0epreventdefault closeschoolsselectschoolulheightswalertopen 1 ifflexdataid flexdataid groupyeargroupby renderloc0fromrenderloc0enablequirksmode0tag tagmiidhidecaption false captionflexdataid groupyear groupmonthdialogoverlaywindowlargemodalbodymoderatecontentlength 0 modulecontentuiswalert functionsettimeoutfunctionpagemoduleinstanceid pmiloadtaggeddatacontaineraattrhrefaddedtag tag containerislinkedenablequirksmode0viewidviewtouse container 2200 documentreadyfunctiongroupbygroupby targetviewvar alertboxidswchanneldropdownhide thisremoveclasshoverhid miidundefined targetviewlengthcovidtrue titleimageheight 487enablequirksmode0viewid viewtouse tagnavigationpolicy0 viewtouse hid8caption imagesrc2 chksidebar settimeoutfunctionifhidmiidsidebarlistviewlengthvideoisembedded false videoiframefunctionif eventkeycodevar sublistrisk6builder view varrenderloc0fromrenderloc0enablequirksmode0tag tagview var viewtouseif alertboxid oklengthtrue videolinktext videoisembeddedfunction loadtaggeddatacontainerfunction e varloaddatacontainer miid pmielse alertboxidraisedbydatepicker etargetclasslistcontainsdatepickeruidialogoverlay uiswalert function0 viewtousecalendarulswpgmenutoplevelremoveclassswpgmenuopenaddclassswpgmenuclosedmediauiswalertattrid click okvideolinktextmiid findtabindexfirstfocus 200li akeypressfunctioneoffice4tag viewtouserenderloc0fromrenderloc0tag tagtrimsublisthtml sublistattrariahiddenloadgroupeddatacontainer miid pmigetcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidtag viewidthrough the dialog487 imagealttextuiswalertattrid clickflexdataid groupyearneweventkeycodegroupyearakeypressfunctione ifewhich13 thisclick functionnavs activeselectoridnowgroupmonth groupbyfield groupbyswinnerwrapheighthidmiiddetailviewvaladdoffcanvasmenuheightforsitenavpressed on datepickergroupyear groupmonth groupmonthlischoolmoderated content doesntescapelist view definedsublistattrariahiddenestopimmediatepropagation epreventdefault getifewhich 13 thisclickfunction loadgroupeddatacontainer miidheightif dialogoverlaywindowlargemodalbodymoderatecontentlength 0nav0 var miidetargetclasslistcontainsdatepicker if raisedbydatepickerhidmiiddetailviewval getcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miiddocumentreadyfunction checkscriptmoduleviewcheckscriptmustachetag enablequirksmode0viewidviewtouse containeriftargetview undefined targetviewlengthelse alertboxid noclicktag viewid targetviewoklengthstrcookiepmi22709beforesettag tagvar renderlocuidialogoverlayclosemodalvisiblelastclickgroupmonth groupbygroupmonth groupbyfieldsurecontent doesntview targetview hidmiiddetailviewvaldatepickerfalse videoiframe1 var renderlocthisremoveclasshover var sublistmiid findtabindexfirstfocushidden detail viewmiid sidebarlistviewvalsettimeoutfunction modulecontentakeypressfunctione ifewhich 13youdomainid 4 varokclickdocumentreadyfunction taglist liesc was pressed0 varbodyonkeydownelementaryalertboxid oklength 0openlinkinnewwindow true videolinktextimagewidthpublic reviewswchanneldropdownhide thisremoveclasshover varsidebarlistviewval getcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miidestopimmediatepropagation epreventdefault closealertboxid okclick elsedialogoverlaywindowlargemodalbodymoderatecontentlengthdoesnt bleed throughmiddleif raisedbydatepicker estopimmediatepropagationuiswalert function eekeycode 27dialog uidialogoverlayclosemodalvisiblelastclickifewhich 13linktextfocuscontentmoduleinstanceidif escinformationundefinedsuccess failurecommunityfailure callcontrollerfailureresult0errormessagevar datasidebar list viewchksidebarviewtouse looksvar failure callcontrollerfailureresult0errormessagehidmiiddetailviewval getcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidfunction loadgroupeddatacontainer27 escapesupportrenderloc0fromrenderloc0groupyear groupyearadded to checkdaymiid sidebarlistviewval getcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid1 if ekeycodedocumentonclicktruerenderlocenablequirksmode0viewidviewtousecheck ifnoclick elsedomainidmiid pmi groupyeargroupmonth groupby taghidetitle true titleswchanneldropdownhidethisclick function loadgroupeddatacontainervideoisembeddedlidatabcsidview varhavehidecaption falseenablequirksmode0viewidhidden sidebarviewtousekey estopimmediatepropagationestopimmediatepropagation epreventdefault checktrue linkurltaglist li akeypressfunctioneetargetclasslistcontainsdatepickerescape key estopimmediatepropagationtargetview containereventsublistattrariahidden trueattrariaexpandedtag container 22false caption

Longtail Keyword Density for Cdaschools.org

KeywordsOccurences
miid pagemoduleinstanceid pmi42
container 2 chksidebar42
getcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid pagemoduleinstanceid42
viewtouse hid- miid28
miid -sidebarlistviewval getcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid28
tag viewtouse looks28
hidden sidebar list28
sidebar list view28
list view defined28
builder view var28
view var viewtouse28
var viewtouse ifhid-miid-sidebarlistviewlength28
viewtouse ifhid-miid-sidebarlistviewlength 028
ifhid-miid-sidebarlistviewlength 0 viewtouse28
0 viewtouse hid-28
hid- miid -sidebarlistviewval28
-sidebarlistviewval getcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid28
groupyear groupmonth groupby28
2 chksidebar function28
groupyear groupmonth groupmonth28
groupmonth groupmonth groupbyfield28
groupmonth groupbyfield groupby28
if ekeycode 2720
ekeycode 27 escape20
27 escape key20
escape key estopimmediatepropagation20
key estopimmediatepropagation epreventdefault20
targetview tag iftargetview14
groupby targetview tag14
tag iftargetview undefined14
flexdataid groupyear groupmonth14
pmi flexdataid groupyear14
hid-miid-detailviewval getcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid14
miid pmi flexdataid14
loaddatacontainer miid pmi14
undefined targetviewlength 014
function loaddatacontainer miid14
chksidebar function loaddatacontainer14
iftargetview undefined targetviewlength14
hidden detail view14
targetviewlength 0 targetview14
chksidebar function loadtaggeddatacontainer14
miid findtabindexfirstfocus 20014
module-content- miid findtabindexfirstfocus14
settimeoutfunction module-content- miid14
chksidebar settimeoutfunction module-content-14
2 chksidebar settimeoutfunction14
enablequirksmode0viewidviewtouse container 214
tag enablequirksmode0viewidviewtouse container14
renderloc0fromrenderloc0tag tag enablequirksmode0viewidviewtouse14
pmi renderloc0fromrenderloc0tag tag14
pagemoduleinstanceid pmi renderloc0fromrenderloc0tag14
pmi tag viewtouse14
miid pmi tag14
loadtaggeddatacontainer miid pmi14
function loadtaggeddatacontainer miid14
targetview container 214
0 targetview looks14
pmi flexdataid flexdataid14
tag tag container14
detail view defined14
builder view targetview14
view targetview hid-miid-detailviewval14
targetview hid-miid-detailviewval getcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid14
pagemoduleinstanceid pmi flexdataid14
flexdataid flexdataid groupyear14
viewid targetview container14
flexdataid groupyear groupyear14
groupyear groupyear groupmonth14
groupbyfield groupby renderloc0fromrenderloc0enablequirksmode0tag14
groupby renderloc0fromrenderloc0enablequirksmode0tag tag14
renderloc0fromrenderloc0enablequirksmode0tag tag viewid14
tag viewid targetview14
tag container 214
groupmonth groupby targetview14
viewtouse tag tag14
0 var miid14
dialog if dialog-overlay-windowlargemodal-bodymoderatecontentlength14
through the dialog14
doesnt bleed through14
content doesnt bleed14
moderated content doesnt14
sure moderated content14
make sure moderated14
check to make14
renderloc 0 var14
dialog-overlay-windowlargemodal-bodymoderatecontentlength 0 module-content-14
var renderloc 014
1 var renderloc14
pageid 1 var14
var pageid 114
4 var pageid14
domainid 4 var14
var domainid 414
documentreadyfunction var domainid14
enablequirksmode0viewid viewtouse tag14
if dialog-overlay-windowlargemodal-bodymoderatecontentlength 014
added to check14
0 module-content- miidfindui-widget-detailfindui-articleappendnbsp14
loadgroupeddatacontainer miid pmi14
groupby enablequirksmode0viewid viewtouse14
groupbyfield groupby enablequirksmode0viewid14
renderloc0fromrenderloc0groupyear groupyear groupmonth14
pmi renderloc0fromrenderloc0groupyear groupyear14
pagemoduleinstanceid pmi renderloc0fromrenderloc0groupyear14
groupby tag viewtouse14
pmi groupyear groupmonth14
miid pmi groupyear14
groupmonth groupby tag14
function loadgroupeddatacontainer miid14
akeypressfunctione ifewhich 1314
module-content- miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction14
documentreadyfunction tag-list li14
tag-list li akeypressfunctione14
li akeypressfunctione ifewhich14
miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction checkscriptmoduleviewcheckscriptmustache14
ifewhich 13 thisclick14
13 thisclick function14
thisclick function loadgroupeddatacontainer14
findtabindexfirstfocus 200 documentreadyfunction11
200 documentreadyfunction var11
epreventdefault get id10
if swalertopen 110
ui-sw-alertlength if swalertopen10
swalertopen 1 if10
1 if ekeycode10
dialog ui-dialog-overlay-closemodalvisiblelastclick else10
ui-dialog-overlay-closemodalvisiblelastclick else remove10
else remove focus10
remove focus etargetblur10
focus etargetblur etargetclasslistremovefocus10
estopimmediatepropagation epreventdefault get10
if alertboxid oklength10
id of open10
open alert var10
alert var alertboxid10
var alertboxid ui-sw-alertattrid10
alertboxid ui-sw-alertattrid click10
ui-sw-alertattrid click ok10
ok or no10
no if alertboxid10
alertboxid oklength 010
oklength 0 alertboxid10
var swalertopen ui-sw-alertlength10
swalertopen ui-sw-alertlength if10
estopimmediatepropagation epreventdefault close10
e var swalertopen10
esc was pressed10
alertboxid okclick else10
etargetclasslistcontainsdatepicker if raisedbydatepicker10
if raisedbydatepicker estopimmediatepropagation10
raisedbydatepicker estopimmediatepropagation epreventdefault10
epreventdefault close dialog10
close dialog ui-dialog-overlay-closemodalvisiblelastclick10
raisedbydatepicker etargetclasslistcontainsdatepicker if10
var raisedbydatepicker etargetclasslistcontainsdatepicker10
datepicker var raisedbydatepicker10
pressed on datepicker10
check if esc10
function e var10
epreventdefault check if10
estopimmediatepropagation epreventdefault check10
else if ekeycode10
noclick else if10
alertboxid noclick else10
else alertboxid noclick10
okclick else alertboxid10
bodyonkeydown ui-dialog-overlay-base-modal ui-dialog-overlay10
ui-dialog-overlay-base-modal ui-dialog-overlay ui-sw-alert10
ui-dialog-overlay ui-sw-alert function10
ui-sw-alert function e10
0 alertboxid okclick10
etargetblur etargetclasslistremovefocus documentreadyfunction9
imagewidth 945 imageheight5
videolinktext videoisembedded false5
if trimsublisthtml sublistattraria-hidden5
trimsublisthtml sublistattraria-hidden trueattraria-expanded5
sublistattraria-hidden trueattraria-expanded false5
videoisembedded false videoiframe5
hidecaption false caption4
var sublist thischildrenul4
false videoiframe flexdataid4
thischildrenul if trimsublisthtml4
945 imageheight 4874
imageheight 487 imagealttext4
islinked true linkurl4
openlinkinnewwindow true videolinktext4
true videolinktext videoisembedded4
sublist thischildrenul if4
data success failure3
var failure callcontrollerfailureresult0errormessage3
hidetitle true title3
sw-channel-dropdownhide thisremoveclasshover var3
thisremoveclasshover var sublist3
data var success3
false caption imagesrc3
linktext click here3
var data var3
groupyear groupmonth56
2 chksidebar42
miid pagemoduleinstanceid42
container 242
view defined42
builder view42
miid pmi42
getcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid42
pagemoduleinstanceid pmi42
estopimmediatepropagation epreventdefault30
-sidebarlistviewval getcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid28
groupmonth groupmonth28
miid -sidebarlistviewval28
groupmonth groupbyfield28
groupbyfield groupby28
hid- miid28
flexdataid groupyear28
pmi flexdataid28
chksidebar function28
viewtouse hid-28
tag viewtouse28
var viewtouse28
0 viewtouse28
ifhid-miid-sidebarlistviewlength 028
viewtouse looks28
viewtouse ifhid-miid-sidebarlistviewlength28
view var28
sidebar list28
hidden sidebar28
groupmonth groupby28
list view28
if ekeycode23
ekeycode 2720
27 escape20
escape key20
key estopimmediatepropagation20
documentreadyfunction var15
0 var15
pmi renderloc0fromrenderloc0groupyear14
renderloc0fromrenderloc0groupyear groupyear14
viewtouse tag14
tag tag14
tag container14
enablequirksmode0viewid viewtouse14
detail view14
function loaddatacontainer14
tag viewid14
findtabindexfirstfocus 20014
miid findtabindexfirstfocus14
module-content- miid14
settimeoutfunction module-content-14
chksidebar settimeoutfunction14
enablequirksmode0viewidviewtouse container14
tag enablequirksmode0viewidviewtouse14
renderloc0fromrenderloc0tag tag14
pmi renderloc0fromrenderloc0tag14
pmi tag14
loadtaggeddatacontainer miid14
function loadtaggeddatacontainer14
targetview container14
viewid targetview14
renderloc0fromrenderloc0enablequirksmode0tag tag14
loaddatacontainer miid14
groupby renderloc0fromrenderloc0enablequirksmode0tag14
groupyear groupyear14
flexdataid flexdataid14
hid-miid-detailviewval getcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid14
targetview hid-miid-detailviewval14
view targetview14
hidden detail14
targetview looks14
0 targetview14
targetviewlength 014
undefined targetviewlength14
iftargetview undefined14
tag iftargetview14
groupby targetview14
targetview tag14
groupby enablequirksmode0viewid14
groupby tag14
var miid14
dialog if14
doesnt bleed14
content doesnt14
moderated content14
sure moderated14
make sure14
renderloc 014
dialog-overlay-windowlargemodal-bodymoderatecontentlength 014
var renderloc14
1 var14
pageid 114
var pageid14
4 var14
domainid 414
var domainid14
if dialog-overlay-windowlargemodal-bodymoderatecontentlength14
bleed through14
0 module-content-14
tag-list li14
loadgroupeddatacontainer miid14
function loadgroupeddatacontainer14
thisclick function14
13 thisclick14
ifewhich 1314
module-content- miidfindui-widget-detailfindui-articleappendnbsp14
li akeypressfunctione14
akeypressfunctione ifewhich14
pmi groupyear14
documentreadyfunction checkscriptmoduleviewcheckscriptmustache14
documentreadyfunction tag-list14
miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction14
comments -112
else if12
200 documentreadyfunction11
alertboxid oklength10
ui-dialog-overlay-base-modal ui-dialog-overlay10
oklength 010
if alertboxid10
no if10
click ok10
ui-sw-alertattrid click10
alertboxid ui-sw-alertattrid10
var alertboxid10
bodyonkeydown ui-dialog-overlay-base-modal10
0 alertboxid10
1 if10
ui-dialog-overlay ui-sw-alert10
ui-sw-alert function10
function e10
e var10
var swalertopen10
swalertopen ui-sw-alertlength10
ui-sw-alertlength if10
if swalertopen10
swalertopen 110
okclick else10
focus etargetblur10
etargetblur etargetclasslistremovefocus10
epreventdefault get10
get id10
alertboxid okclick10
open alert10
else alertboxid10
ui-dialog-overlay-closemodalvisiblelastclick else10
alert var10
var raisedbydatepicker10
raisedbydatepicker etargetclasslistcontainsdatepicker10
datepicker var10
etargetclasslistcontainsdatepicker if10
if raisedbydatepicker10
raisedbydatepicker estopimmediatepropagation10
alertboxid noclick10
close dialog10
dialog ui-dialog-overlay-closemodalvisiblelastclick10
epreventdefault close10
else remove10
remove focus10
if esc10
check if10
noclick else10
epreventdefault check10
etargetclasslistremovefocus documentreadyfunction9
click here9
var sublist6
if trimsublisthtml6
sublistattraria-hidden trueattraria-expanded5
trueattraria-expanded false5
trimsublisthtml sublistattraria-hidden5
videoisembedded false5
videolinktext videoisembedded5
false videoiframe5
pmi-22709before content5
imagewidth 9455
945 imageheight5
if eventkeycode5
function if4
activeselectorid aattrhref4
0 if4
high school4
islinked true4
sublist thischildrenul4
thischildrenul if4
public schools4
hidecaption false4
coeur dalene4
imageheight 4874
487 imagealttext4
false caption4
true linkurl4
reopening plan4
openlinkinnewwindow true4
true videolinktext4
videoiframe flexdataid4
school board4
media max-width4
success failure3
data success3
failure callcontrollerfailureresult0errormessage3
active class3
var failure3
pagenavigationstatecookie function3
var success3
lidata-bcsid activeselectorid3
navs- activeselectorid3
activeselectorid aattrtarget3
policy updates3
risk level3
middle school3
magnet school3
sw-channel-dropdownhide thisremoveclasshover3
thisremoveclasshover var3
public review3
district office3
data var3
hidetitle true3
true title3
caption imagesrc3
linktext click3
var data3
var149
miid140
if128
viewtouse98
tag98
097
function93
view87
pmi84
groupmonth84
groupyear70
documentreadyfunction58
targetview56
groupby56
flexdataid47
pagemoduleinstanceid44
143
builder42
chksidebar42
getcontenthttpswwwcdaschoolsorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid42
hidden42
defined42
looks42
container42
alertboxid40
else39
list30
school30
estopimmediatepropagation30
epreventdefault30
ifhid-miid-sidebarlistviewlength28
hid-28
sidebar28
groupbyfield28
-sidebarlistviewval28
module-content-28
check27
225
dialog24
false23
ekeycode23
321
li21
swalertopen20
key20
true20
content20
click20
raisedbydatepicker20
escape20
undefined18
417
make16
open16
ifewhich14
enablequirksmode0viewid14
akeypressfunctione14
thisclick14
here14
checkscriptmoduleviewcheckscriptmustache14
tag-list14
settimeoutfunction14
loadgroupeddatacontainer14
514
findtabindexfirstfocus14
enablequirksmode0viewidviewtouse14
renderloc0fromrenderloc0tag14
loadtaggeddatacontainer14
viewid14
renderloc0fromrenderloc0enablequirksmode0tag14
hid-miid-detailviewval14
detail14
targetviewlength14
iftargetview14
renderloc0fromrenderloc0groupyear14
miidfindui-widget-detailfindui-articleappendnbsp14
loaddatacontainer14
dialog-overlay-windowlargemodal-bodymoderatecontentlength14
sure14
through14
domainid14
614
pageid14
renderloc14
added14
set14
moderated14
bleed14
doesnt14
activeselectorid13
comments13
713
close13
remove12
no12
e11
documentonclick11
esc11
get11
id11
district11
etargetclasslistremovefocus10
navigation10
etargetblur10
oklength10
focus10
ui-sw-alertattrid10
ui-dialog-overlay-closemodalvisiblelastclick10
etargetclasslistcontainsdatepicker10
alert10
ok10
pressed10
bodyonkeydown10
ui-dialog-overlay-base-modal10
ui-dialog-overlay10
ui-sw-alert10
ui-sw-alertlength10
datepicker10
okclick10
noclick10
public10
page9
elementary8
eventkeycode7
schools7
imageheight7
imagewidth7
active6
sublist6
pm6
policy6
all6
failure6
swinnerwrapheight6
home6
you6
channel6
sublistattraria-hidden6
coeur6
success6
data6
trimsublisthtml6
href6
videolinktext5
videoisembedded5
videoiframe5
userregid5
class5
pmi-22709before5
review5
linkurl5
media5
trueattraria-expanded5
85
start5
openlinkinnewwindow5
linktext5
islinked5
hidetitle5
updates5
sw-channel-dropdownhide5
section5
our5
information5
isedit5
caption5
title5
hidecaption5
imagesrc5
95
imagealttext5
104
documentonmouseover4
families4
now4
114
office4
navs-4
documentonmouseout4
nbsp4
us4
sub4
aattrhref4
thischildrenul4
community4
info4
high4
dalene4
site4
cda4
middle4
thisremoveclasshover4
124
support4
reopening4
plan4
max-width4
pagenavigationstatecookie4
calendar4
board4
meeting4
october4
magnet4
ulsw-pgmenu-toplevelremoveclasssw-pgmenu-openaddclasssw-pgmenu-closed3
strcookie3
eventdateid3
addoffcanvasmenuheightforsitenav3
lidata-bcsid3
chevron3
selectschoolulheight3
activechannelnavtype3
sitenavulheight3
ului-breadcrumbs3
openpagesubmenuthisparent3
aattrtarget3
licollapsibleeachfunction3
nav3
skip3
blackboard3
add3
every3
options3
event3
zindex3
parentzindex3
buttonproplinkhref3
already3
swgotosearchresultspageswsearchinput3
covid3
center3
callcontrollerfailureresult0errormessage3
windowlocation3
end3
height3
divsw-special-mode-bar3
special3
wednesday3
risk3
app3
day3
find3
donate3
meetings3
resources3
assistance3
new3
newsletter3
your3
level3
website3
moduleinstanceid3
133
have3
am3
clicking3
family3
api3

Who hosts Cdaschools.org?

Cdaschools.org Hosting Provider Information

Hosted IP Address:52.206.191.232
Hosted Hostname:ec2-52-206-191-232.compute-1.amazonaws.com
Service Provider:Amazon.com, Inc.
Hosted Country:United StatesUS
Location Latitude:39.0481
Location Longitude:-77.4729
Webserver Software:awselb/2.0

Is "Amazon.com, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%

HTTP Header Analysis for Cdaschools.org

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: awselb/2.0
Date: Sun, 18 Oct 2020 03:59:26 GMT
Content-Type: text/html
Content-Length: 134
Connection: keep-alive
Location: https://www.cdaschools.org:443/

Cdaschools.org Domain Nameserver Information

HostIP AddressCountry
ns1.nwednet.com 162.218.181.6
ns2.nwednet.com 162.218.181.214


Need to find out who hosts Cdaschools.org?


Domain Registration (WhoIs) information for Cdaschools.org

 Domain Name: CDASCHOOLS.ORG
Registry Domain ID: D96657280-LROR
Registrar WHOIS Server: whois.wildwestdomains.com
Registrar URL: http://whois.wildwestdomains.com
Updated Date: 2018-01-22T17:34:22Z
Creation Date: 2003-03-21T19:48:06Z
Registry Expiry Date: 2023-03-21T19:48:06Z
Registrar Registration Expiration Date:
Registrar: Wild West Domains, LLC
Registrar IANA ID: 440
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4806242505
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Coeur d'Alene School District 271
Registrant State/Province: Idaho
Registrant Country: US
Name Server: NS1.NWEDNET.COM
Name Server: NS2.NWEDNET.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-09-20T02:32:16Z

Websites with Similar Names

Cdasc.ca
Centre d'affaires St-Charles
Cdaschols.org
cdaschols.org
Cdaschools.org
Coeur d‘Alene Public Schools / Homepage

Recently Updated Websites

Roxici.com (1 second ago.)Wasabihouse.ca (1 second ago.)Ridiculouslycheapstocks.com (1 second ago.)Tiguemusic.com (1 second ago.)Cactus-import.com (2 seconds ago.)Worldpokerplayers.net (2 seconds ago.)Kok5765.com (2 seconds ago.)Eser.com (2 seconds ago.)Submariners.ru (3 seconds ago.)Laureenjacobs.com (3 seconds ago.)Tyc0529.com (3 seconds ago.)Bentoforbusiness.tech (3 seconds ago.)Akkumulatorbolt.com (3 seconds ago.)Rajkumarjewellers.com (3 seconds ago.)Tedx360.com (3 seconds ago.)Gorgeousdc.com (3 seconds ago.)Firstminute.love (3 seconds ago.)Influgency.com (3 seconds ago.)Tebsoozani.com (3 seconds ago.)Thecoffins.com (4 seconds ago.)Get424kchecks.com (4 seconds ago.)Sagagruppe.com (4 seconds ago.)Futuresplash.org (4 seconds ago.)Thomasdarr.net (4 seconds ago.)Wagerprogames.com (4 seconds ago.)Breze.farm (4 seconds ago.)Judithmorgan.com (4 seconds ago.)Dragon-fly-designs.ca (5 seconds ago.)Neowifi.app (5 seconds ago.)Namteplo.org.ua (5 seconds ago.)

Recently Searched Keywords

get ready for the 🐱👧 moment of truth and dare 🐱👧 to live with escorts in ja... (1 second ago.)isinvesti (1 second ago.)when you 🍀🎍 see escorts in jaipur you will 🍀🎍 be amazed how 🍀🎍 pretty i am (1 second ago.)experienced 🍯🍒 jaipur call girls with 🍯🍒 style and charm available for serv... (2 seconds ago.)hello my ✨⚡️ dears, outcall escort services in jaipur only at ✨⚡️ home and ... (2 seconds ago.)serendipity lyrics (3 seconds ago.)my name is aliya i am a ☃️🐠 very nasty jaipur call girl (3 seconds ago.)jaipur call girls 🎑🎆 great passion is sex 🎑🎆 in all its forms (4 seconds ago.)hc tp (4 seconds ago.)jaipur escorts 🍸🎽 only make home 🍸🎽 and hotel office 🍸🎽 visits (5 seconds ago.)成功案例分享 英文 (5 seconds ago.)i am monica a 23 🍒🍬 years young jaipur escort who is 🍒🍬 very open 🍒🍬 about ... (6 seconds ago.)beautiful and 👩‍👙 multi-orgasmic jaipur call girls (7 seconds ago.)debugger variable (7 seconds ago.)arina is a 26 👩‍🔬 years old, super dirty 👩‍🔬 and affectionate jaipur call g... (7 seconds ago.)ϲ���ǾƵ� (8 seconds ago.)fantastically 🐦🐤 pretty sexy jaipur escorts like to fulfill 🐦🐤 your horny 🐦... (8 seconds ago.)hospitals and clinics (8 seconds ago.)delay 500 (8 seconds ago.)are you 🎒👕 looking for escorts in jaipur who fulfills your 🎒👕 kinky fantasi... (9 seconds ago.)107 (10 seconds ago.)i5 gaming pcs (11 seconds ago.)›› (11 seconds ago.)hello my 🍈🍣 name is kira, a nice jaipur escort who is 🍈🍣 hungry for 🍈🍣 sex (11 seconds ago.)cash advance debt consolidation insurance match admin.com (12 seconds ago.)hello and welcome 🐧🗿 to escorts jaipur very horny girl is 🐧🗿 here for you (12 seconds ago.)escorts in jaipur (13 seconds ago.)call girls in jaipur (14 seconds ago.)escort services in jaipur (15 seconds ago.)434 - tortino di gamberi porri e zucchine..antipasto di natale sopraffine! (antipasto di pesce) (15 seconds ago.)