Ceteclavras.com.br

Website Thumbnail
Checking...
CETEC Lavras | Cursos técnicos, profissionalizantes e a distância.

Safety: Low trust score
Year Founded: 2012
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-20
Category: This site has not been categorized yet

Escolha entre Curso Técnico, Curso Profissionalizante ou Curso a Distância. Na CETEC Lavras você encontra um novo mundo de possibilidades.


Domain summary

Domain label
ceteclavras
Domain extension
com.br
Domain registered:
2012-05-23
Domain updated:
2020-05-25
Domain expires:
2021-05-23
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is ceteclavras.com.br ranked relative to other sites:

Percentage of visits to ceteclavras.com.br from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Ceteclavras.com.br registered?
A: Ceteclavras.com.br was registered 8 years, 6 months, 6 days, 16 hours, 39 minutes, 17 seconds ago on Wednesday, May 23, 2012.
Q: When was the WHOIS for Ceteclavras.com.br last updated?
A: The WHOIS entry was last updated 6 months, 4 days, 16 hours, 39 minutes, 17 seconds ago on Monday, May 25, 2020.
Q: What are Ceteclavras.com.br's nameservers?
A: DNS for Ceteclavras.com.br is provided by the following nameservers:
  • ns12.wixdns.net
  • ns13.wixdns.net
Q: Who is the registrar for the Ceteclavras.com.br domain?
A: The domain has been registered at BR-NIC.
Q: What is the traffic rank for Ceteclavras.com.br?
A: Ceteclavras.com.br has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Ceteclavras.com.br each day?
A: Ceteclavras.com.br receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Ceteclavras.com.br resolve to?
A: Ceteclavras.com.br resolves to the IPv4 address 23.236.62.147.
Q: In what country are Ceteclavras.com.br servers located in?
A: Ceteclavras.com.br has servers located in the United States.
Q: What webserver software does Ceteclavras.com.br use?
A: Ceteclavras.com.br is powered by webserver.
Q: Who hosts Ceteclavras.com.br?
A: Ceteclavras.com.br is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Ceteclavras.com.br worth?
A: Ceteclavras.com.br has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Ceteclavras.com.br Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Ceteclavras.com.br Free SEO Report

Website Inpage Analysis for Ceteclavras.com.br

H1 Headings

0 :

H2 Headings

1 :
  1. UM NOVO MUNDO DE POSSIBILIDADES

H3 Headings

4 :
  1. "A MELHOR MANEIRA DE PREVER O SEU FUTURO É CRIÁ-LO"
  2. CRIE O SEU FUTURO
  3. FAÇA A ESCOLHA CERTA
  4. "NÃO DEIXE QUE SEUS MEDOS TOMEM O LUGAR DOS SEUS SONHOS"

H4 Headings

2 :
  1. CURSOS TÉCNICOS
  2. CURSOS PROFISSINALIZANTES

H5 Headings

3 :
  1. CONTATO
  2. FUNCIONAMENTO
  3. SIGA

H6 Headings

18 :
  1. Administração
  2. Design de Interiores
  3. Enfermagem
  4. Gastronomia
  5. Segurança do Trabalho
  6. Agricultura
  7. Edificações
  8. Estética
  9. Meio Ambiente
  10. Beleza e Estética
  11. Cabeleireiro
  12. Confeitaria
  13. Culinária Japonesa e Chinesa
  14. Eletricista e NR10
  15. Gestão Empresarial
  16. Cozinha Internacional
  17. Mestre Cervejeiro
  18. (35) 3821-2428

Total IFRAMEs

4 :

Total Images

36 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

20:
  1. Ceteclavras Técnico
    https://www.ceteclavras.com.br
  2. Ceteclavras Profissionalizante
    https://www.ceteclavras.com.br
  3. Ceteclavras Administração
    https://www.ceteclavras.com.br/curso/T%C3%89CNICO/T%C3%89CNICO-EM-ADMINISTRA%C3%87%C3%83O
  4. Ceteclavras Design de Interiores
    https://www.ceteclavras.com.br/curso/T%C3%89CNICO/T%C3%89CNICO-EM-DESIGN-DE-INTERIORES
  5. Ceteclavras Enfermagem
    https://www.ceteclavras.com.br/curso/T%C3%89CNICO/T%C3%89CNICO-EM-ENFERMAGEM
  6. Ceteclavras Gastronomia
    https://www.ceteclavras.com.br/curso/T%C3%89CNICO/T%C3%89CNICO-EM-GASTRONOMIA
  7. Ceteclavras Segurança do Trabalho
    https://www.ceteclavras.com.br/curso/T%C3%89CNICO/T%C3%89CNICO-EM-SEGURAN%C3%87A-DO-TRABALHO
  8. Ceteclavras Agricultura
    https://www.ceteclavras.com.br/curso/T%C3%89CNICO/T%C3%89CNICO-EM-AGRICULTURA
  9. Ceteclavras Edificações
    https://www.ceteclavras.com.br/curso/T%C3%89CNICO/T%C3%89CNICO-EM-EDIFICA%C3%87%C3%95ES
  10. Ceteclavras Estética
    https://www.ceteclavras.com.br/curso/T%C3%89CNICO/T%C3%89CNICO-EM-EST%C3%89TICA
  11. Ceteclavras Meio Ambiente
    https://www.ceteclavras.com.br/curso/T%C3%89CNICO/T%C3%89CNICO-EM-MEIO-AMBIENTE
  12. Ceteclavras Beleza e Estética
    https://www.ceteclavras.com.br/curso/profissionalizante/BELEZA-E-EST%C3%89TICA
  13. Ceteclavras Cabeleireiro
    https://www.ceteclavras.com.br/curso/profissionalizante/CABELEIREIRO
  14. Ceteclavras Confeitaria
    https://www.ceteclavras.com.br/curso/profissionalizante/CONFEITARIA
  15. Ceteclavras Culinária Japonesa e Chinesa
    https://www.ceteclavras.com.br/curso/profissionalizante/CULIN%C3%81RIA-JAPONESA-E-CHINESA
  16. Ceteclavras Eletricista e NR10
    https://www.ceteclavras.com.br/curso/profissionalizante/ELETRICISTA-%2B-NR-10
  17. Ceteclavras Gestão Empresarial
    https://www.ceteclavras.com.br/curso/profissionalizante/GEST%C3%83O-EMPRESARIAL
  18. Ceteclavras Cozinha Internacional
    https://www.ceteclavras.com.br/curso/PROFISSIONALIZANTE/COZINHA-INTERNACIONAL
  19. Ceteclavras Mestre Cervejeiro
    https://www.ceteclavras.com.br/curso/PROFISSIONALIZANTE/MESTRE-CERVEJEIRO
  20. https://www.ceteclavras.com.br
    https://www.ceteclavras.com.br

Links - Internal (nofollow)

0:

Links - Outbound

2:
  1. https://www.facebook.com/ceteclavras/
    https://www.facebook.com/ceteclavras/
  2. http://www.rc2c.com.br
    http://www.rc2c.com.br

Links - Outbound (nofollow)

0:

Keyword Cloud for Ceteclavras.com.br

color292929stylek6nvsrijbuttoniconimagecalc100 326px 05lavras cursos tcnicostcnico curso profissionalizantewidth100height100backgroundrgba255cetec1pxfontnormal normalarial sansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenterprofissionalizanteiframewebkitfullscreen minheightautoarial sansserifdisplaynonetcnicosnninfosvgtypeshapeviewbox0helveticaneuew0255roma helveticaneuew1055roma helveticastylek6nvsrhasymbolprofissionalizante oucurso profissionalizante0sencontracalc100327px 05323px 05marginleft calc100 980pxostylek6nvsriomenucontainerarrowstylek6nvsriomenucontainercenterdirectionnormal 23px14emstylek6nvsriomenucontainersvgcontainer249 1backgroundcolorrgba255solid transparent41 41 1borderradius0entre curso tcnicooldirrtl3encontra um novo323pxstylek6nvsrijdatastateloggedincalc100 327px 051borderradius0selectdataerrortruetxtnew ulopacity1normaln nninfosvgtypeshapeviewbox0umcursos tcnicos profissionalizantespaddingrightinitialpaddingleft14pxstylek6nvsrijdatastateloggedout40stylek6nvsrhalink stylek6nvsrhasymbolhelvetica arial sansserifdisplaynonetextalignrightmarginleft calc100 323px41 1borderradius0solidprofissionalizantesstylek6nvsrhalinkcetec lavras vocrgba411marginleft calc100 327px255 255iframenormal 23px14em breew01thinobliquesansserififrame positionabsolutewidth100height100overflowhiddenstylek6nvsrhatextwrapperstylek6nvsrhamenucontainernovometakeywordsseopagetitleseocetec lavrasou cursoavenirltw0185heavy1475544sansserififprofissionalizante ou cursostylek6nvsriosubmenubeforeborderstylesolidbordercolorrgba249 249um novodostylek6nvsrhaitem stylek6nvsrhalinkentreease 0scalc100 323px 05helveticaneuew1055roma helvetica arialfont normalhelveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055romacurso tcnico curso255 09fontsize0margintop5pxnoverflowhiddenhelveticaneuew1055roma helvetica255 255 1cursostylek6nvsrijavatarsvgcalc100 657px 0stylek6nvsrhalink stylek6nvsrhatextwrapperselectdatapreviewerror stylek6nvsriomenucontainerarrow14px14emstylek6nvsriomenucontainerarrowe a distnciapageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpiwly6lrabgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlenascer2distnciapageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpiwly6lrabgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlenascer donormal normal normalstylek6nvsriomenucontainerleftdirection249 1backgroundcolorrgba255 255stylek6nvsrioitemhoverareafirstchildwidth100height100backgroundrgba255 255 255selectdatapreviewerrorencontra umlavras cursosstylek6nvsrijbuttoniconsvg326px 05calc100 657pxentre cursominheightauton n nninfosvgtypeshapeviewbox0tcnico cursomundopaddingright14pxpaddingleftinitialultxtnewhelveticaneuew0155romacolor0099fftextdecorationunderlinecursorpointeryourcolor373737fontfamilyhelveticastylek6nvsrhaactivestylek6nvsrhaitemstylek6nvsrhalightbackgroundcolorrgba255 255displaynonestylek6nvsriolabelspancolor ffffffna cetec lavrascalc100 980pxtcnicorgba41 41stylek6nvsrhaitemfontnormalfont normal normalsansserifdisplaynonestylek6nvsrijbuttonsoucursos326pxhelveticaneuew0155roma helveticaneuew0255romaavenirltw0185heavy1475544sansserif color292929voc encontranninfosvgtypeshapeviewbox0 0transparent255 255 09fontsize0margintop5pxulstylek6nvsrhalink stylek6nvsrhatextwrapper stylek6nvsrhalabelpositionabsolutetop0left0color373737width100height1000 0positionabsolutetop0right0bottom0left06helveticaneuew0255romastylek6nvsrijloginstylek6nvsrijicontcnicos profissionalizantesstylek6nvsrhamenucontainer stylek6nvsrhaitem stylek6nvsrhalinkmetakeywordsseopagetitleseoceteclb1itemscontainerstylek6nvsrhasymbolstylek6nvsrhamenucontainernacolorpositionstaticboxshadow000 0 0helvetica arial sansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenteremetakeywordsseopagetitleseocetec lavras cursospositionstaticboxshadow00009fontsize0margintop5pxdistnciapageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpiwly6lrabgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlenascernovo mundonormal 14px14em breew01thinobliquesansserifborderradius0fonteasevaroverflowvisiblebreew01thinobliquesansserifminheightauto importantmargin0lineheightnormalletterspacingnormal txtnewstylek6nvsrhaactivestylek6nvsrhaitemstylek6nvsrhadarkdivnthchild2iframewebkitfullscreen minheightauto important41 41rgba41 41 41stylek6nvsriosubmenulavrasseusol ulfontfamilyhelvetica neue helveticaneuew0155romastylek6nvsriomenucontainer1backgroundcolorrgba255mundo de possibilidadestextalignleftmargin0lineheightnormalletterspacingnormal657pxbackgroundcolorlavras vocna cetec05borderstylesolidbordercolorrgba249 249 249textaligncenterolsansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncentersvg overflowvisiblen nselectfocusn nninfosvgtypeshapeviewbox0 0calc100 323pxstylek6nvsrijdatastateloggedin stylek6nvsrijdropdownmenustylek6nvsrijdropdownmenuvocum novo mundo980pxtxtnewvoc encontra umdistncia na ceteccurso profissionalizante oustylek6nvsrhatextwrapper stylek6nvsrhalabelselectdatapreviewfocus23px14em breew01thinobliquesansserif1backgroundcolorrgba255 255fontfamilyhelvetica neuehelveticaneuew1055romaffffffhelvetica arialcursos tcnicoswidth100height100backgroundrgba255 255249 249normal 14px14emdisplayinlineblockstylek6nvsriomenucontainerarrowstylek6nvsriomenucontainerleftdirectionstylek6nvsrhalink stylek6nvsrhasymbolstylek6nvsrhamenucontainerbackgroundcolor ffffffstylek6nvsriomenucontainercenterdirectioncolora8a8a714px14em breew01thinobliquesansserifcolor373737fontfamilyhelvetica neueemnormal normal 23px14empossibilidades metakeywordsseopagetitleseocetecstylek6nvsriosubmenu stylek6nvsrioitemstylek6nvsrioitem borderradius0calc100 980px 05normal normalhelveticaneuew0255roma helveticaneuew1055romaborderwidth2px borderstylesolidbordercolorrgba249borderwidth2px borderstylesolidbordercolorrgba249 249fontnormal normal normal04s ease 0swidth100height100arial657px 00 0 0distnciastylek6nvsrijdatastatertlprofissionalizantes eselectdatapreviewhoverstylek6nvsrijavatarimagedistncia nasvgstylek6nvsrhatextwrappersolid rgba41 41pointereventsnone255 1 stylek6nvsriomenucontainerpositionstaticboxshadow000 0importantstrc1inlinecontentstylek6nvsrhaitem stylek6nvsrhalink stylek6nvsrhatextwrapperstylek6nvsrhalink stylek6nvsrhatextwrapperstylek6nvsrhamenucontainerstylek6nvsrioitem04s easestylek6nvsriomenucontainerarrow stylek6nvsriomenucontainersvgcontainersolid rgba41327pxcetec lavrasstylek6nvsriomenucontainerrightdirectioncalc100 326pxstylek6nvsrioitem backgroundcolorrgba255 255neue helveticaneuew0155roma helveticaneuew0255romastylek6nvsrijdatastateltriframewebkitfullscreenvectoreffectnonscalingstrokestrc1dataresponsivemarginleft calc100 657px204 204stylek6nvsrijdropdownmenu a divnthchild2backgroundcolorrgba255 255 255stylek6nvsrijtext04s980px 05que23px14emmarginleft calc100 326px02s1 stylek6nvsriomenucontainerpositionabsolutewidth100height100overflowhiddentcnicos profissionalizantes estylek6nvsrhaactivestylek6nvsrhaitemstylek6nvsrhalight stylek6nvsrhalinknormal normal 14px14emstylek6nvsrijdatastateloggedout stylek6nvsrijlogin249 249 1backgroundcolorrgba255stylek6nvsrhamenucontainer stylek6nvsrhaitem1backgroundcolorrgba255 255 255lavras voc encontrastylek6nvsrioitem backgroundcolorrgba255curso tcnicoselecthoverstylek6nvsrhamenucontainer255 1backgroundcolorrgba255stylek6nvsriomenucontainerarrowstylek6nvsriomenucontainerrightdirectionb0b0b0stylek6nvsrhaactivestylek6nvsrhaitemstylek6nvsrhadark stylek6nvsrhalinkstylek6nvsrhalabelmarginleft calc100neue helveticaneuew0155romapossibilidadesborderwidth2pxneuecolor373737fontfamilyhelvetica neue helveticaneuew0155romaborderstylesolidbordercolorrgba249marginleftfontfamilyhelveticahelveticastylek6nvsrijarrowcalc100 327pxstylek6nvsrioitemhoverarealastchildultxtnew olcurso a distncia5possibilidades metakeywordsseopagetitleseocetec lavras

Longtail Keyword Density for Ceteclavras.com.br

KeywordsOccurences
calc100 980px 0560
margin-left calc100 980px60
font normal normal11
normal normal normal10
style-k6nvsrhaitem style-k6nvsrhalink style-k6nvsrhatext-wrapper9
positionstaticbox-shadow000 0 08
255 255 18
rgba41 41 417
0 0 07
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma6
margin-left calc100 327px6
calc100 327px 056
um novo mundo6
margin-left calc100 657px6
calc100 657px 06
normal normal 14px14em6
helveticaneuew02-55roma helveticaneuew10-55roma helvetica6
helveticaneuew10-55roma helvetica arial6
neue helveticaneuew01-55roma helveticaneuew02-55roma6
normal 14px14em bree-w01-thin-obliquesans-serif6
distncia na cetec5
tcnicos profissionalizantes e5
lavras cursos tcnicos5
mundo de possibilidades5
encontra um novo5
voc encontra um5
fontnormal normal normal5
lavras voc encontra5
entre curso tcnico5
curso tcnico curso5
tcnico curso profissionalizante5
curso profissionalizante ou5
profissionalizante ou curso5
curso a distncia5
cetec lavras voc5
na cetec lavras5
cursos tcnicos profissionalizantes5
calc100 323px 054
margin-left calc100 323px4
1background-colorrgba255 255 2554
style-k6nvsrhamenucontainer style-k6nvsrhaitem style-k6nvsrhalink4
border-width2px border-stylesolidborder-colorrgba249 2494
solid rgba41 414
normal 23px14em bree-w01-thin-obliquesans-serif4
normal normal 23px14em4
background-colorrgba255 255 2554
border-stylesolidborder-colorrgba249 249 2494
249 249 1background-colorrgba2554
249 1background-colorrgba255 2554
255 1 style-k6nvsriomenucontainer4
style-k6nvsrhalink style-k6nvsrhatext-wrapper style-k6nvsrhalabel3
e a distnciapageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpiwly6lrabgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlenascer3
n n nninfosvgtypeshapeviewbox03
metakeywordsseopagetitleseocetec lavras cursos3
possibilidades metakeywordsseopagetitleseocetec lavras3
41 41 1border-radius03
calc100 326px 053
color373737font-familyhelvetica neue helveticaneuew01-55roma3
iframe-webkit-full-screen min-heightauto important3
width100height100backgroundrgba255 255 2553
255 255 09font-size0margin-top5px3
margin-left calc100 326px3
helvetica arial sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter3
font-familyhelvetica neue helveticaneuew01-55roma3
helvetica arial sans-serifdisplaynone3
04s ease 0s3
style-k6nvsrioitem background-colorrgba255 2553
style-k6nvsrijdropdownmenu a divnth-child23
n nninfosvgtypeshapeviewbox0 03
margin-left calc10079
calc100 980px60
980px 0560
normal normal28
0 017
255 25514
style-k6nvsrhaitem style-k6nvsrhalink13
style-k6nvsrhalink style-k6nvsrhatext-wrapper12
font normal11
41 419
255 18
positionstaticbox-shadow000 08
style-k6nvsrijdata-stateloggedin style-k6nvsrijdropdownmenu7
margin0line-heightnormalletter-spacingnormal txtnew7
rgba41 417
normal 14px14em6
cursos tcnicos6
um novo6
novo mundo6
calc100 657px6
657px 06
helveticaneuew01-55roma helveticaneuew02-55roma6
helveticaneuew02-55roma helveticaneuew10-55roma6
helveticaneuew10-55roma helvetica6
14px14em bree-w01-thin-obliquesans-serif6
style-k6nvsrhalink style-k6nvsrhasymbol6
helvetica arial6
neue helveticaneuew01-55roma6
cetec lavras6
327px 056
calc100 327px6
lavras cursos6
tcnicos profissionalizantes5
profissionalizantes e5
n n5
1 style-k6nvsriomenucontainer5
lavras voc5
fontnormal normal5
entre curso5
tcnico curso5
encontra um5
style-k6nvsrhamenucontainer style-k6nvsrhaitem5
curso profissionalizante5
profissionalizante ou5
ou curso5
distncia na5
voc encontra5
na cetec5
curso tcnico5
1background-colorrgba255 2554
323px 054
calc100 323px4
249 2494
249 1background-colorrgba2554
background-colorrgba255 2554
border-stylesolidborder-colorrgba249 2494
solid transparent4
txtnew ul4
solid rgba414
background-color ffffff4
color ffffff4
style-k6nvsrioitem border-radius04
23px14em bree-w01-thin-obliquesans-serif4
normal 23px14em4
style-k6nvsriosubmenu style-k6nvsrioitem4
border-width2px border-stylesolidborder-colorrgba2494
metakeywordsseopagetitleseocetec lavras3
possibilidades metakeywordsseopagetitleseocetec3
style-k6nvsrhalink style-k6nvsrhatext-wrapperstyle-k6nvsrhamenucontainer3
distnciapageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpiwly6lrabgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlenascer do3
avenir-lt-w0185-heavy1475544sans-serif color2929293
n nninfosvgtypeshapeviewbox03
41 1border-radius03
svg overflowvisible3
ultxtnew ol3
ol ul3
style-k6nvsrhatext-wrapper style-k6nvsrhalabel3
style-k6nvsrhalink style-k6nvsrhasymbolstyle-k6nvsrhamenucontainer3
iframe positionabsolutewidth100height100overflowhidden3
style-k6nvsrhaactivestyle-k6nvsrhaitemstyle-k6nvsrhalight style-k6nvsrhalink3
calc100 326px3
style-k6nvsrioitem background-colorrgba2553
204 2043
style-k6nvsriomenucontainerarrow style-k6nvsriomenucontainersvgcontainer3
selectdata-previewerror style-k6nvsriomenucontainerarrow3
ease 0s3
style-k6nvsrijdata-stateloggedout style-k6nvsrijlogin3
04s ease3
326px 053
style-k6nvsrhaactivestyle-k6nvsrhaitemstyle-k6nvsrhadark style-k6nvsrhalink3
arial sans-serifdisplaynone3
font-familyhelvetica neue3
arial sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter3
color373737font-familyhelvetica neue3
255 09font-size0margin-top5px3
width100height100backgroundrgba255 2553
min-heightauto important3
iframe-webkit-full-screen min-heightauto3
nninfosvgtypeshapeviewbox0 03
calc10079
margin-left79
0573
980px60
normal47
042
color36
background-color36
128
style-k6nvsrhalink27
style-k6nvsrioitem19
style-k6nvsrijdata-stateloggedin19
218
txtnew18
style-k6nvsriosubmenu15
lavras15
style-k6nvsriomenucontainer15
displaynone15
curso15
style-k6nvsrhaitem14
style-k6nvsrhamenucontainer13
313
positionabsolutetop0right0bottom0left012
style-k6nvsrhatext-wrapper12
style-k6nvsrijdropdownmenu11
e11
ul11
important11
bree-w01-thin-obliquesans-serif11
style-k6nvsriomenucontainerarrow11
font11
cursos10
svg9
solid9
border-radius08
48
overflowhidden8
positionstaticbox-shadow0008
style-k6nvsrijlogin8
n8
ffffff8
var7
cetec7
margin0line-heightnormalletter-spacingnormal7
ol7
na7
voc7
rgba417
56
neue6
helveticaneuew01-55roma6
helveticaneuew02-55roma6
style-k6nvsriomenucontainerarrowstyle-k6nvsriomenucontainerleft-direction6
style-k6nvsrijarrow6
style-k6nvsriomenucontainerarrowstyle-k6nvsriomenucontainerright-direction6
style-k6nvsriomenucontainerarrowstyle-k6nvsriomenucontainercenter-direction6
style-k6nvsrijicon6
helvetica6
arial6
style-k6nvsrijdata-stateloggedout6
helveticaneuew10-55roma6
um6
width100height1006
style-k6nvsrhasymbol6
14px14em6
profissionalizante6
positionabsolutetop0left0color373737width100height1006
mundo6
novo6
657px6
profissionalizantes6
distncia6
tcnicos6
327px6
if5
fontnormal5
avenir-lt-w0185-heavy1475544sans-serif5
possibilidades5
encontra5
ou5
tcnico5
style-k6nvsrijbuttoniconsvg5
entre5
style-k6nvsrijavatarsvg5
o5
ultxtnew5
do4
323px4
style-k6nvsrijtext4
padding-right14pxpadding-leftinitial4
1background-colorrgba2554
transparent4
border-stylesolidborder-colorrgba2494
64
1px4
02s4
style-k6nvsrioitemhoverarealast-child4
lb1itemscontainer4
b0b0b04
iframe4
23px14em4
colora8a8a74
border-width2px4
background-colorrgba2554
style-k6nvsriolabel4
color2929294
positionabsolutewidth100height100overflowhidden3
text-alignright3
style-k6nvsrhaactivestyle-k6nvsrhaitemstyle-k6nvsrhadark3
style-k6nvsrhaactivestyle-k6nvsrhaitemstyle-k6nvsrhalight3
style-k6nvsrhatext-wrapperstyle-k6nvsrhamenucontainer3
style-k6nvsrhasymbolstyle-k6nvsrhamenucontainer3
style-k6nvsrhalabel3
oldirrtl3
text-aligncenter3
strc1data-responsive3
your3
text-alignleft3
pointer-eventsnone3
que3
326px3
strc1inlinecontent3
seus3
overflowvisible3
em3
vector-effectnon-scaling-stroke3
1border-radius03
metakeywordsseopagetitleseocetec3
distnciapageuriseohomehidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidc1dmpiwly6lrabgmetadatapageidc1dmpispresetfalseschemaversion20ishiddenfalsemediareftypewixvideoidc1dmpdesktopmediarefmetadatapageidc1dmpispresetfalseschemaversion10ishiddenfalsetitlenascer3
iframe-webkit-full-screen3
09font-size0margin-top5px3
min-heightauto3
style-k6nvsrioitemhoverareafirst-child3
style-k6nvsriosubmenubefore3
style-k6nvsriomenucontainersvgcontainer3
style-k6nvsriomenucontainerleft-direction3
0s3
selecthover3
selectdata-previewhover3
selectfocus3
selectdata-previewfocus3
selectdata-errortrue3
selectdata-previewerror3
style-k6nvsriomenucontainerright-direction3
ease3
style-k6nvsriomenucontainercenter-direction3
04s3
divnth-child23
width100height100backgroundrgba2553
span3
opacity13
sans-serifdisplaynone3
style-k6nvsrijbuttons3
style-k6nvsrijdata-stateltr3
font-familyhelvetica3
style-k6nvsrijdata-statertl3
padding-rightinitialpadding-left14px3
color0099fftext-decorationunderlinecursorpointer3
style-k6nvsrijbuttoniconimage3
displayinline-block3
style-k6nvsrijavatarimage3
sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter3
color373737font-familyhelvetica3
nninfosvgtypeshapeviewbox03

Who hosts Ceteclavras.com.br?

Ceteclavras.com.br Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Not Applicable

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%

HTTP Header Analysis for Ceteclavras.com.br

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Tue, 20 Oct 2020 08:10:17 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.ceteclavras.com.br/
content-language: en
X-Wix-Request-Id: 1603181417.560536355024074618679
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: 6ivkWfREES4Y8b2pOpzk7Owfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVi P0yj8Af8/paqX0JLrR68,2d58ifebGbosy5xc FRalruPxfx6b44l/mRxyDCZ3HWIqQuI78MLnvd17953bD3eI67vTCidmwZTXYg2hl2vYQ==,2UNV7KOq4oGjA5 PKsX47BzxWFBtKoqbaB2M/rwsEsk=,m0j2EEknGIVUW/liY8BLLqzP lZWXbpqWiuMr47ysAg=,dvEkI3CoQ26/kOBf/eu3DEPt/SiR glIy2a6CjVs/pAaWyug/ZdHQ36uOAkr89T0,nxVDKlf5lZ8xGkFSmm2J1jvKQ nzIX4xRTxBlstTa8yPIdnFEhJcFi3P39v irX2H2yWikl2EP5bJKtoyukhjw==
Cache-Control: no-cache
Expires: -1

Ceteclavras.com.br Domain Nameserver Information

HostIP AddressCountry
ns12.wixdns.net 216.239.36.101
ns13.wixdns.net 216.239.38.101


Need to find out who hosts Ceteclavras.com.br?


Domain Registration (WhoIs) information for Ceteclavras.com.br

 % Copyright (c) Nic.br
% The use of the data below is only permitted as described in
% full by the terms of use at https://registro.br/termo/en.html ,
% being prohibited its distribution, commercialization or
% reproduction, in particular, to use it for advertising or
% any similar purpose.
% 2020-09-22T03:00:19-03:00 - IP: 165.232.33.17

domain: ceteclavras.com.br
owner: HUGO AGUIAR 01519173610
owner-c: HUAGU
tech-c: BCG24
nserver: ns12.wixdns.net
nsstat: 20200921 AA
nslastaa: 20200921
nserver: ns13.wixdns.net
nsstat: 20200921 AA
nslastaa: 20200921
saci: yes
created: 20120523 #9920950
changed: 20200525
expires: 20210523
status: published

nic-hdl-br: HUAGU
person: Hugo Aguiar.
created: 20070508
changed: 20191022

nic-hdl-br: BCG24
person: Bruno Couto Gomes
created: 20050825
changed: 20191128

% Security and mail abuse issues should also be addressed to
% cert.br, http://www.cert.br/ , respectivelly to Login to show email
and Login to show email
whois.registro.br accepts only direct match queries. Types
% of queries are: domain (.br), registrant (tax ID), ticket,
% provider, CIDR block, IP and ASN.

Websites with Similar Names

Cetec-colombia.net
CETEC – Capacitación, consultoría y servicios en tecnología, especializados en el área de IT.
Cetec-info.org
index_maintenance
Cetec.cl
Default Web Site Page
Cetec.edu.ar
..:: CETeC - Centro de Estudios Terciarios del Comahue ::..
Cetecbahia.com.br
..:: CETECBAHIA ::..
Ceteccampusmiraval.com
PREPARATORIA CETEC
Ceteccurso.com
Suspended Domain
Ceteccursos.com
Coming Soon
Cetececuador.com
Cursos de Capacitación en Quito - Ecuador

Recently Updated Websites

Bondslab.com 8 seconds ago.Arconai.me 19 seconds ago.Nmschoolforthearts.org 21 seconds ago.Rins.ru 24 seconds ago.Tracc.co.uk 31 seconds ago.Grom2.ru 32 seconds ago.Newyearseve.live 36 seconds ago.Pspro.com 39 seconds ago.Abacuscambridge.com 43 seconds ago.Mimigenuki-nikkenkamisori.jp 45 seconds ago.Pcscheer.com 47 seconds ago.Plantinavia.se 49 seconds ago.Publika.org 50 seconds ago.Stac-japan.jp 57 seconds ago.Keqi-cable.com 1 minute ago.Thetoolboxisyou.com 1 minute 2 seconds ago.Reactpaths.com 1 minute 15 seconds ago.Nefen.ru 1 minute 16 seconds ago.Randalldsmith.com 1 minute 19 seconds ago.Gtlremodeling3.com 1 minute 21 seconds ago.Khanefootball.com 1 minute 22 seconds ago.Fyixalthupoerh.club 1 minute 22 seconds ago.Publika.net 1 minute 28 seconds ago.Gokhanhaytoglu.com 1 minute 28 seconds ago.Zgnlkjw.com.cn 1 minute 30 seconds ago.Mumsinthewood.com 1 minute 33 seconds ago.Kumar-lederkleidung.de 1 minute 33 seconds ago.Fundacionesperanzayalegria.org 1 minute 34 seconds ago.Tehran-it.com 1 minute 35 seconds ago.Spidersharp.com 1 minute 39 seconds ago.