|  Home / CGIAR
Low trust score  | 
A Global Agricultural Research Partnership Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:C
Alexa Rank Alexa Rank:41,008
Majestic Rank Majestic Rank:6,011
Domain Authority Domain Authority:74%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: CGIAR.ORG
Registry Domain ID: D981561-LROR
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2015-12-20T01:28:21Z
Creation Date: 1994-02-16T05:00:00Z
Registry Expiry Date: 2018-02-17T05:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited
Registry Registrant ID: C2826082-LROR
Registrant Name: CGNET Hostmaster
Registrant Organization: CGIAR Consortium Office
Registrant Street: Agropolis International
Registrant Street: Avenue Agropolis
Registrant City: Montpellier
Registrant State/Province:
Registrant Postal Code: 34394
Registrant Country: FR
Registrant Phone: +1.6508336000
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C150330967-LROR
Admin Name: CGIAR Consortium
Admin Organization:
Admin Street: 1000 Avenue Agropolis
Admin City: Montpellier
Admin State/Province:
Admin Postal Code: 34394
Admin Country: FR
Admin Phone: +33.0467043826
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C3370522-LROR
Tech Name: Ricardo Uribe
Tech Organization: CGNET
Tech Street: 949 Hamilton Ave
Tech City: Menlo Park
Tech State/Province: CA
Tech Postal Code: 94025
Tech Country: US
Tech Phone: +1.6508336000
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: NS-1511.AWSDNS-60.ORG
Name Server: NS-49.AWSDNS-06.COM
Name Server: NS-752.AWSDNS-30.NET
Name Server: NS-1858.AWSDNS-40.CO.UK
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of WHOIS database: 2017-09-01T11:17:23Z

Who hosts is hosted by New Dream Network, LLC in Texas, Irving, United States, 75014. has an IP Address of and a hostname of Web Server Information

Hosted IP Address:
Service Provider:New Dream Network, LLC
Hosted Country:United StatesUS
Location Latitude:32.814
Location Longitude:-96.9489
Webserver Software:Not Applicable
Google Map of 50,12

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 23 Jun 2015 15:39:17 GMT
Server: Apache
Link:; rel=shortlink
Vary: Accept-Encoding
Content-Encoding: gzip
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

haslink removeclassifepreventdefault2017 locationyoutubecommunicationgaresponse fbtrackcgiar cgiarnutritiongaq1gender2function target fbtracktargettypeofpimjselsefbloading30 2017metapropertyogurl attr contentprogramhealthfbrootourusergeneticcontentpracticesattr contentmetapropertyogurlrwandalinkedinclimateappfacebookcgiarknowledgeaugust 30 2017augusthrefmetapropertyogurl attrfunction targetfbapigoogle youtubewindowfbprofilelinkresponsefunctiontheirlikelinkedin googleif typeoffuturepaperfunction responseurlaugust 30attrlinkedin google youtubetarget fbtrackstrategytwitter linkedin googlesystemtwitter linkedingooglefbtrackcgiar highlightsrspcgiar eventsfunction rspvarnew in researchcgiar cgiar highlightscgiar researchagriculturetwitternulleventstruescientistsdocument0newsserviceshighlightsrsp iffunction response fbtrackfbeventsubscribenewschangeundefinedpakistanagriculturalshareremoveclassactionfoodwhat8217starget fbeventsubscriberesourcesccafsthisdatalocationidwhat8217s newresearchhave

Longtail Keyword Density for

august 30 20175
function response fbtrack4
function target fbtrack3
metapropertyogurl attr content3
cgiar cgiar highlights3
linkedin google youtube3
new in research3
twitter linkedin google3
cgiar cgiar7
attr content6
30 20175
function response5
august 305
function rsp4
cgiar highlights4
response fbtrack4
function target3
target fbtrack3
target fbeventsubscribe3
link removeclass3
metapropertyogurl attr3
cgiar events3
what8217s new3
google youtube3
linkedin google3
cgiar research3
2017 location3
if typeof3
twitter linkedin3
rsp if3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States DNS Record Analysis DNS Lookup

cgiar.orgNS600Target: cgnetdns1.CGNET.COM
cgiar.orgNS600Target: dns2.zoneedit.COM
cgiar.orgNS600Target: ns18.zoneedit.COM
cgiar.orgSOA86400MNAME: DNS5.CGNET.COM
Serial: 3837099187
Refresh: 1200
Retry: 600
Expire: 1209600
cgiar.orgMX600Priority: 10
cgiar.orgMX600Priority: 20
cgiar.orgTXT600TXT: MS=ms93035761
cgiar.orgTXT600TXT: v=spf1
cgiar.orgTXT600TXT: v=spf1
cgiar.orgTXT600TXT: b4u5bX1PfomzX6Vz48SO95UYustzZV3MeWUMk1Ps
cgiar.orgTXT600TXT: MS=ms58006130

Alexa Traffic Rank for

Alexa Search Engine Traffic for