Chad-O-Chef | Quality Gas Braais & Gas Fireplaces | South Africa

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9

South African Manufactured Stainless Steel Gas Braais, Kitchen Grill Extractor systems and Flueless Gas Fireplaces. Home of South Africa's only Hybrid Braai



Domain summary

Last updated
2020-10-14
Domain label
chad-o-chef
Domain extension
co.za
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Chad-o-chef.co.za registered?
A: Chad-o-chef.co.za was registered 11 months, 1 week, 1 day, 11 hours, 43 minutes, 35 seconds ago on Wednesday, October 14, 2020.
Q: When was the WHOIS for Chad-o-chef.co.za last updated?
A: The WHOIS entry was last updated 11 months, 1 week, 1 day, 11 hours, 43 minutes, 35 seconds ago on Wednesday, October 14, 2020.
Q: What are Chad-o-chef.co.za's nameservers?
A: DNS for Chad-o-chef.co.za is provided by the following nameservers:
  • ns1.host-h.net
  • ns2.host-h.net
  • ns1.dns-h.com
Q: Who is the registrar for the Chad-o-chef.co.za domain?
A: The domain has been registered at UniForum Association.
Q: What is the traffic rank for Chad-o-chef.co.za?
A: Chad-o-chef.co.za has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Chad-o-chef.co.za each day?
A: Chad-o-chef.co.za receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Chad-o-chef.co.za resolve to?
A: Chad-o-chef.co.za resolves to the IPv4 address 23.236.62.147.
Q: In what country are Chad-o-chef.co.za servers located in?
A: Chad-o-chef.co.za has servers located in the United States.
Q: What webserver software does Chad-o-chef.co.za use?
A: Chad-o-chef.co.za is powered by webserver.
Q: Who hosts Chad-o-chef.co.za?
A: Chad-o-chef.co.za is hosted by GOOGLE in Iowa, Council Bluffs, United States, 51502.
Q: How much is Chad-o-chef.co.za worth?
A: Chad-o-chef.co.za has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Chad-o-chef.co.za Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Chad-o-chef.co.za Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Chad-o-chef.co.za

H1 Headings

0 :

H2 Headings

2 :
  1. -  Quality Gas Products  -
  2. Watch our featured Videos

H3 Headings

15 :
  1. Chad-O-Chef - Boma Braai Potjie
  2. Al Fresco Pizza Oven - Lasagne
  3. Chad-O-Chef - Flame Line Fireplace (Black Mirror)
  4. Chad-O-Chef - Hybrid Braai Ember Drawer
  5. NomadiQ Bbq - Chicken Wings
  6. Chad-O-Chef - Picture Fireplace Burning
  7. Chad-O-Chef - Prego steaks on the Boma Braai
  8. Al Fresco Pizza Oven - Beef Roast
  9. Enjoy Our Special Recommendations
  10. Boma Braai
  11. Flameline Drop-In Fireplace (VFSL-1600)
  12. The Outdoor Firepit Kit
  13. Boma Braai
  14. Flameline Drop-In Fireplace (VFSL-1600)
  15. The Outdoor Firepit Kit

H4 Headings

1 :

H5 Headings

3 :
  1. [email protected]
  2. 011 668 1910/1
  3. 063 603 6067

H6 Headings

1 :
  1. STYLE, SAFETY & QUALITY THAT LASTS

Total IFRAMEs

2 :

Total Images

24 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

7:

Links - Outbound (nofollow)

0:

Keyword Cloud for Chad-o-chef.co.za

system kitchenbackgroundcolor ffffffupu1channel has nofontnormal normaldivdataplayablehookplayercontainerdataplayabledataplayableinfullscreentrue 3gbolhelveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055romaweborderradius0 positionabsolutetop0right0bottom0left0transitionbordercolor 04s10px 00 noonlyyoullbeen1backgroundcolorrgba255 25526quantitycounter1985873316quantitycounternormal normal 24px133emoven beefease 0s backgroundcolortooltip287621785rootdropdownerror168152165rootoverflowhidden3s9hzwingscount1valuefire gratecount1valuefireplacecount1valueflamescount1valuegaswidth100sansseriflineheight14377 292s easeinoutbordercolorextractor system kitchentranslatey07pxcompj9xxdo653tstqalfresco pizza oven0 07bordercolorrgba0 0helveticaneuew1055roma helvetica arial249 1backgroundcolorrgba255africanmade in ourborder0complete yourflamefontsize14pxmargintop5pxfontfamilyhelvetica neue2934 2060 4680flame linepopover2070100914popoverdataplacementtoptooltip287621785witharrowpaddingbottom6pxperfection0positionrelativewhitespacenowrappopover2070100914popoverdataplacementtooltip287621785popoveranimationexittooltip287621785popoveranimationexitactiveopacity0transitiontransform 80ms linearapplyopacitypopover2070100914popoverdataplacementtoptooltip287621785popoveranimationenteropacity0transformscale9dropdownoption978924491dropdownoptionvideoscontainermax549pizza16px15empositionabsolutetop0right0bottom0left0transitionbordercolor 04simagebutton1datastatepressednormal 16px15em nimbussanstw01consansserifcompj3oezpdnnormal normal 20px14emal fresco pizza33frescopizza ovenwoodnormal 16px15em nimbussanstw01consansseriftextdecorationpotjies60 80 80chadochefnimbussanstw01consansserif color000000110 029110z3e 3cglyphhas nostylej9ph853elinkpopover2070100914popoverdataplacementtooltip287621785popoveranimationexitopacity1transformscale160 80normalkaku gothicneue helveticaneuew0155roma helveticaneuew0255romacook nearly anythingcan cookmargin0divdataplayablehookplayercontainerdataplayablemaxwidth550pxli2970 29110z3enimbussanstw01consansseriffontnormal normal31px 16pxcompj3oezpdnbraaicount1valuechadochefcount1valueflamelinecount1valueflamescount1valuelesagnecount1valuenomadiqcount1valuepizza ovencount1valuepizzabomajustifycontentflexstartdivdataplayablehookplayercontainerdataplayabledataplayableinfullscreentrue11029 3420 6046grill modernal3wnybtransformtranslatez0compj9xxdo6505w3hiragino kaku21firecounter2727760664rootbraai ember drawer702932px 0margin0lineheightnormalletterspacingnormal txtnewpopover2070100914popovercontentbackgroundcolorf64d43border1px solidselectdatapreviewerror stylek8fj46zlnavcontainerarrowstylej9ph853elabelroastchefcount1valueuniversal gratecount1valuewoodfresco pizza oven1 1gratecount1valuefireplacecount1valueflamescount1valuegas firecount1valuegasfirecount1valueprego steakcount1valueshadownormal normalflame line fireplaceeasecounter2727760664btnborderstylesolidbordercolorrgba249 249divroast was cookedeventschadochef0 06our al fresco0 0 0south africasstylek8fj46zlnavcontainercenterdirectionstylek0qkha77bg8020 3329 7029videoscontainermax449normal normal 14px20pxhave accessonly takegas fireplaces home0 0 rgba0screeno chefcount1valuechadoconfirmationpopover2070100914popoverdataplacementleft tooltip287621785tpaarrowright0width7pxheight12pxwood1s linearo255 1burning pizzachadosystemprego779 11029lasagne was made16pxcompj9xxdo65ovencount1valuewoodeaseinoutbordercolor 2s easeinoutcolorfireplaces householddelicious2ddgw slickdots06compj3oezpdnsvgcolorf64d43stainless steel extractor33291inscfontsize75px0 0 1pxalfrescocounter2727760664btnbackground0versatile youperiod4680 8020 3329calc100 980pxhelveticabraais kitchendropdownoption978924491dropdownoption dropdown294681846dropdowndropdown1750531977contentvisible dropdownbase207754212rootcompj3oezpdn28stylek8fj46zlnavcontainerarrowdropdown1750531977dropdowncontentnormal normal 16px1cubicbezier25464594applyopacitygratecount1valuefireplacecount1valueflamescount1valuegasarial sansseriflineheight1437029 110 0opacity0borderstylesolidbordercolorrgba249perfectly2scompj9xxdo65grillimportantzindex50cooked chickennormal 16px1shadow40 0o chefpopover2070100914popovercontentbackgroundcolor212121padding4px 12pxborder1px 75757504s80px14em2060braais kitchen grillbeef8020 3329tooltip287621785tpaarrowtop0width12pxheight7pxgas braai stainless4px 8px 0transparentaccesseaseinoutcolor 2sstartsnormal normal 14px143emcubicbezier25464594transformscale1 translatey03gbol8080 2033980px 05resetsystems and fluelessnormal 15px14em nimbussanstw01consansseriftextdecorationvideospopover2070100914popoverdataplacementtooltip287621785popoveranimationentertooltip287621785popoveranimationenteractiveopacity1transitiontransform 120ms cubicbezier25464594applyopacity16px1gothic prosansseriffontsize14pxwebkitfontsmoothingautoboxshadow0now1inscfontsize60px20 34 46helveticaneuew0155roma helveticaneuew0255romatooltip287621785tpaarrow0 4px06fontnormal normalnormal 80px14em80 80 33make3gbol pfpc5displaynonecompj9xxdo65stylek8fj46zlrepeaterbuttonlabeldivdatahookwixvodwidgetdirectioncontainerdirltr14px144em nimbussanstw01consansseriftextdecorationfireplacesstylek8ejjyjblabelwrapper50backgroundsize100 1000compj9xxdo650 rgba0 0popover2070100914popoverdataplacementtooltip287621785popoveranimationentertooltip287621785popoveranimationenteractiveopacity1transitiontransformpfpc5displaynonecompj9xxdo65tooltip287621785tpaarrow svgdisplayblockblack mirror1pxbackgroundcolor 04s ease4px9110 2934 206027204 1bordersolid120ms cubicbezier25464594applyopacitypopover2070100914popoverdataplacementtop tooltip287621785tpaarrowbottom0width12pxheight7pxfindsteelfgolapadding02pxburgers07colorrgba255 255ovenwood burning6046 8080 2033helvetica arial sansseriflineheight143burning ovencount1valuewoodheredropdown294681846dropdownpicture fireplacepopover2070100914popoverdataplacementtooltip287621785popoveranimationentertooltip287621785popoveranimationenteractiveopacity1transitiontransform 120msmake potjiesdropin077page1px rgba0 011029 3420cooksolid rgba0chef chadochefeventspublisherchadochefbbq chicken07colorrgba255 255 255cubicbezier25464594transformscale137pxcompj9xxdo65298080transitioncolor 04sbraai3sc7knotonlyoftypelastoftype3420 6046 8080normal normal 14px144emperfectly equippedgratecount1valuewood burning ovencount1valuewoodovenfind out29110z3ecubicbezier25464594transformscale1 translatey0 translatex00 0 06fontnormalbraaicount1valuebraaicount1valueburgerscount1valuechad o chefcount1valuechadonimbussanstw01consansseriftextdecoration compj3oezpdnextractorfullour black0 0 03compj3oezpdnhelveticaneuew1055romaovencount1valuepizza ovencount1valuepotjiecount1valueroastcount1valuebomacount1valuebomajp72r255 255 07colorrgba0rgba0 0757575 solidborderradius3pxcolorffflineheight20pxfontfamilyhelveticaneuew0145lighhelveticaneuew0245lighhelveticaneuew1045lighhelvetica neuehelveticaarialmeiryofont normal normalchefcount1valueuniversal gratecount1valuewood burningmaxwidth599pxcompj9xxdo65selecthoverversatile1dinirgba0005compj9xxdo65gratecount1valuewoodkitchen extractor gas27i2rplural3329 7029 110popover2070100914popoverdataplacementbottompizza oven beefnormal normal 14px1normal 14px20px nimbussanstw01consansserifcompj3oezpdn249 1backgroundcolorrgba255 255120ms cubicbezier25464594transformscale1txtnew20 70our alfrescodropdown294681846dropdowndropdown1750531977contentvisible12pxborder1px 757575 solidborderradius3pxcolorffflineheight20pxfontfamilyhelveticaneuew0145lighhelveticaneuew0245lighhelveticaneuew1045lighhelveticarightsteel gaslifestylebeef roast04s ease 0spopover2070100914popovercontentbackgroundcolor212121padding4px 12pxborder1px1inscfontsize80px important2934110 0 400 0 06divdataplayablehookplayercontainerdataplayableminwidth579px 1dinikitchen grill extractor2033 2970 29110z3e3mnyncompj9xxdo65positionabsolutetop0right0bottom0left02033 29703o33d32our black mirror9 77normal 24px133empaddingtop calc100frescocount1valuealfrescocount1valueboma braaicount1valuechadochefcount1valueflamelinecount1valueflamescount1valuelesagnecount1valuenomadiqcount1valuepizza30cook nearly120 042compj3oezpdn33 20 70cooked0 03compj3oezpdnnormal 16px1 nimbussanstw01consansseriftextdecorationactioncolorpickeritem459055545radioouterboxshadow0 0 0topautobottom0chado chef2zthn2ahc6ouroutdoordropdownbase207754212rootbutton894595444upgrade12px14emvideopublishedts1597671395statenullcustomcoverurlnullmediatypesecurevideotrailerinfonullsubscriptiononlyfalsemediaexternurlnullfeatureditemnullstatsinfocategoriescount1valuetravelcooked to perfection14px1 nimbussanstw01consansseriftextdecorationpopover2070100914popoverdataplacementrighttooltip287621785witharrowpaddingleft6pxnearly40 9 77249 249up to watchtranslatex0kitchenpopover2070100914popovercontentbackgroundcolor212121padding4px1 stylek8fj46zlnavcontainerselectdatapreviewfocusflueless gasdelicious beef roast8080 2033 2970blacknormal normal normal0 rgba0nimbussanstw01consansseriftextdecoration compj3oezpdn dropdownoption2205199676rootnotdropdownoption2205199676selectablekitchen extractormirror flameline30tbh 2mzy16px14em nimbussanstw01consansseriftextdecorationbraaicount1valuechadochefcount1valueflamelinecount1valueflamescount1valuelesagnecount1valuenomadiqcount1valuepizza ovencount1valuepizza ovencount1valuepotjiecount1valueroastcount1valuebomacount1valuebomabackgroundcolorrgba255 255 255potjies watchstylek8fj46zlrepeaterbuttondatastatedropfrescocount1valuealfrescocount1valuebomaextractor gas22extractor systemsvideoscontainermin800steakcount1valueshadowdropdownoption978924491dropdownoption dropdown294681846dropdown dropdownbase207754212rootcompj3oezpdn33 2020px15em312060 4680 8020kakugas braais kitchensolidborderradius3pxcolorffflineheight20pxfontfamilyhelveticaneuew0145lighhelveticaneuew0245lighhelveticaneuew1045lighhelvetica neuehelveticaarialmeiryo15px14em nimbussanstw01consansseriftextdecoration compj3oezpdnpopover2070100914popoverdataplacementrightpopover2070100914popoverdataplacementtooltip287621785popoveranimationexitopacity1transformscale1 translatey0steakcount1valueshadow chefcount1valueuniversal gratecount1valuewoodchefcount1valueuniversalpfpc57pxembed15chadochef hybrid braai20popover2070100914arrowborderwidth5pxrgba0001fresco pizzajustifycontentflexend06borderwidth1pxcompj3oezpdnchannelpositionfixed importantleftauto importantzindex50914px20px3pxsteakcount1valueshadow chefcount1valueuniversalyou can cooksignedgas braai80 80francovencount1valuepotjiecount1valueroastcount1valuebomacount1valueboma braaicount1valuebraaicount1valueburgerscount1valuechad3rqkm07bordercolorrgba0stylek8ehupgflabelwrapper70 29 110gas braais gasstylek8ehupgflabelhybrid braai ember120msfireplace blackgrill extractor systemscan cook nearlynormal 14px1frescopizzabackgroundcolor 04slikegratecount1valuefireplacecount1valueflamescount1valuegas firecount1valuegasfirecount1valuepregogas grill modernoven is sopositionabsolutetop0right0bottom0left0transitionbordercolor 04s ease1px rgba0110 20 34inputbackgroundffffffcolor000000fontnormal normal3s9hz 30tbh15px14em07colorrgba0 0firecount1valuegasfirecount1valueprego40 0 77980ms linearapplyopacitywatch this video0 rgba0005compj9xxdo65077 91108px 0popover2070100914popovercontentbackgroundcolorf64d43border1px solid rgba255255255257fontoldirrtlovencount1valuepotjiecount1valueroastcount1valuebomacount1valueboma braaicount1valuebraaicount1valueburgerscount1valuechad oextractor gas grill2iuvkpayment haschadactioncardhover14px143emdirrtl 2ddgw14px143em nimbussanstw01consansseriftextdecoration compj3oezpdnstainless steel gasfontsize14pxmargintop5pxfontfamilyhelvetica neue helveticaneuew0155romastylek8ehupgflinkhelveticaneuew1055roma helveticajustifycontentcenter70 29jle3h3ds0zchannel videosnormal 20px14em1bordersolid12px14em nimbussanstw01consansserifcompj3oezpdno chefcount1valuechado chefcount1valuechadochefcount1valuechicken3sdropdownbase207754212rootcompj3oezpdn dropdownoption978924491dropdownoptionshadow chefnormal normal 14px14em255 07colorrgba0divdataplayablehookplayercontainerdataplayablemaxwidth1900px101sdivdataplayablehookplayercontainerdataplayablemaxwidth639pxnomadiqislandsconfirmation emailborderwidth2px borderstylesolidbordercolorrgba249 2493omks14px1232zthn 3rqkm1nvsz 2ddgwoutdoor firepithome46 60colorpickeritem459055545radioouterboxshadow012pxborder1px 75757546 60 801bordersolid rgba0 0receiveequipped to makedatafocussourcekeynormal 14px20pxknow14frescocount1valuealfrescocount1valueboma braaicount1valuechadochefcount1valueflamelinecount1valueflamescount1valuelesagnecount1valuenomadiqcount1valuepizza ovencount1valuepizzasteel extractordropdownoption2205199676rootnotdropdownoption2205199676selectableneue helveticaneuew0155roma077 9110 2934gas fireplacesralewaysansserifsystem kitchen extractor8020tooltip287621785tpaarrowdisplayblockpositionabsolutemargin007colorrgba00 06fontnormalpositionabsolutetop0right0bottom0left0transitionbordercolor10pxslickdots lirgba000120 0 4pxnormal 17px14em40 91krbwstainless steellineuigmjpopover2070100914popoverdataplacementbottomtooltip287621785popoveranimationenteropacity0transformscale9coloroption2215770673coloroptionquality gas braaisso versatile you13stylek8ejjyjblinkgas grillothernormal 14px143em nimbussanstw01consansseriftextdecorationequippedoven this oven07colorrgba255ovencount1valuewood burningpizza oven woodcounter2727760664btndisableddropdownoption2205199676titlecompj3oezpdn14px144emmrb7qo7ejhoverw3hiragino kaku gothicpopover2070100914popoverdataplacementrighttooltip287621785popoveranimationenteropacity0transformscale9africas only hybridbuttoncompj9xxdo6529 110 2929 110 20000000fontnormalnormal normal 20px15emborderstylesolidbordercolorrgba249 249 249qualitynormal 14px143emnormal 16px14em nimbussanstw01consansseriftextdecoration0 0 07bordercolorrgba0rgba000120manufacturedalfresco pizza0s1812pxemailborderradius00s backgroundcoloroven woodovencount1valuepizza16px1 nimbussanstw01consansseriftextdecoration0px 16pxcompj3oezpdnfontweight500takepathfill000000compj3oezpdnhousehold heatingchicken wingspopover2070100914popoverdataplacementlefttooltip287621785witharrowpaddingright6px0 0 06compj3oezpdntxtnew ulavailableflamesstylek8fj46zlnavcontainerchannel hasease 0snewyour payment has1backgroundcolorrgba2553a6qsimportantleftauto importantzindex50borderradius0 positionabsolutetop0right0bottom0left0transitionbordercolor20px1lryc2ddgw25has beenyou can120ms cubicbezier25464594applyopacity 120ms32pxhelveticaneuew0255roma helveticaneuew1055roma helveticapaddingtoppopover2070100914popoverdataplacementtop0 779oven wood burningnormal 16px15emlinearapplyopacity 80mslasagnenormal normal 12px14emmanufactured stainless steelvargas fireplaces householdbackgroundcolorrgba204255 07colorrgba0 0normal 12px14em nimbussanstw01consansserifcompj3oezpdnaccountgxjuxstylek8fj46zlnavcontainerrightdirectionfieldsetdisableddropdownnativeselect2882533990erroricon06411029ovenwoodwfont312c760e2157d715de4c44a75417aef3b136e0wf0e2157d715de4c44a75417aeforigfreestylescripttextdecorationextractor systemshot0padding6pxborder0cursorpointergrill modern fireplacepopover2070100914popoverdataplacementtooltip287621785popoveranimationexittooltip287621785popoveranimationexitactiveopacity0transitiontransformmodernfirecount1valuegasfirecount1valueprego steakcount1valueshadowheight24inputpadding0border0textaligncenterwidth100line fireplace blackno0 07bordercolorrgba0receive a confirmation29 110dropdownbase207754212rootcompj3oezpdn3329 702916px1 nimbussanstw01consansseriftextdecoration compj3oezpdn6pxcompj9xxdo6516pxtranslatey3pxhouseholdselectdatapreviewerror28px 10pxbraaicount1valuebraaicount1valueburgerscount1valuechadpopover2070100914popoverdataplacementtooltip287621785popoveranimationexitopacity1transformscale1 translatey0 translatex0your80ms linearapplyopacity 80mslinearhelvetica arialsolid rgba0 0calc100 980px 050 06fontnormal normal04s easesolid14px20px nimbussanstw01consansserifcompj3oezpdn30tbh35senormal 14px14em nimbussanstw01consansserifcompj3oezpdn8pxemail when yournormal normal 80px14emstylek8ejjyjblabelpopover2070100914popoverdataplacementright tooltip287621785tpaarrowleft0width7pxheight12pxproducts3uack0 rgba000120buttonnext3636878588contentoverflowvisibletextoverflowunsetwhitespaceunset12pxborder1pxbackgroundcolor170 06compj3oezpdnpopover2070100914popoverdataplacementtoptooltip287621785popoveranimationenteropacity0transformscale9 translatey3px3420 6046tooltip287621785tpaarrowleft0width7pxheight12px19backgroundcolorrgba255inputbackgroundffffffcolor000000fontnormalsolidborderradius3pxcolorffflineheight20pxfontfamilyhelveticaneuew0145lighhelveticaneuew0245lighhelveticaneuew1045lighhelveticasopaymentsvgcompj9xxdo65normal 14px144em nimbussanstw01consansseriftextdecorationafricas onlybackgroundcolorrgba255 255boma braaipicturemonthlybraai is perfectlysvg3420dropdownoption978924491dropdownoption dropdown294681846dropdowndropdown1750531977contentvisiblefireplace flueless2s easeinoutcolor 2srgba000120 0b0b0b0signcompj3oezpdn dropdownoption2205199676rootnotdropdownoption2205199676selectable3sc7knotonlyoftypefirstoftypeeaseinoutcolorfull screenpayment has beenfireplace flueless gasbackgroundcolorrgba204 204 204dropdown294681846dropdown dropdownbase207754212rootcompj3oezpdnnormal 16px14em80 33 20kitchen grilllb1itemscontainermake potjies watchonce yourcounter2727760664btndisabledcursordefault0 1px rgba01ezungas fireplaces southanything14px143em nimbussanstw01consansseriftextdecorationgreat shot9110selectfocuschadochef picturedropdownoption2205199676titlecompj3oezpdn dropdownoption978924491dropdownoptioninputmscleardisplaynone4px 8pxpurchasedivdataplayablehookplayercontainerdataplayablemaxwidth350pxflueless0 40 9backgroundcolorrgba0 0 0colorpickeritem459055545radiooutercompj3oezpdneventstagscount1valueal frescocount1valuealfrescocount1valuebomasvgdisplayblockcubicbezier25464594applyopacity 120mschefcount1valuechado chefcount1valuechadochefcount1valuechickennormal 14px1 nimbussanstw01consansseriftextdecoration8px 0 rgba000120imagebutton1datastatehoveredbackgroundcolorrgba0stylek8fj46zlnavcontainerarrow stylek8fj46zlnavcontainersvgcontainerdropdownoption978924491dropdownoption dropdown294681846dropdowntooltip287621785tpaarrowright0width7pxheight12px2970 29110z3e 3cglyphsolid rgba255255255252nnohafricassteak burgers0 0 1stylej9ph853elabelwrappertransitioncolor 04s easepopover2070100914popoverdataplacementbottomtooltip287621785popoveranimationenteropacity0transformscale9 translatey3px3wnybcompj9xxdo65pro w3hiragino kakurgba0normal normal 16px15emneuehelveticaarialmeiryo2mzy16px15em nimbussanstw01consansseriftextdecoration compj3oezpdnprosansseriffontsize14pxwebkitfontsmoothingautoboxshadow0 4pxbraais gas fireplacesdropdown294681846rootdropdown294681846mobiletextaligninitialdisplayflexalignitemscenterpositionstaticboxshadow000 0chefchad oshot of our255 07compj3oezpdn0 0 06borderwidth1pxcompj3oezpdn6046 808014px14em nimbussanstw01consansserifcompj3oezpdn204 1bordersolid rgba0div paddingleft17pxchadochef hybridnormal normal 16px14emffffffsolidborderradius3pxcolorffflineheight20pxfontfamilyhelveticaneuew0145lighhelveticaneuew0245lighhelveticaneuew1045lighhelvetica neuehelveticaarialmeiryo proeventstagscount1valueal4680 80207029 110havefirepitautotextoverflowellipsiswhitespacenowrapoverflowhidden07compj3oezpdn1bordercolorrgba0 0south africas only0 52youll receiveyour paymentpopover2070100914popoverdataplacementbottomtooltip287621785witharrowpaddingtop6pxdropdown294681846dropdowndropdown1750531977contentvisible dropdownbase207754212rootcompj3oezpdnchadochef picture fireplace000pizza ovenbraaicount1valuebraaicount1valueburgerscount1valuechad o0 rgba0001flamelinecolor249 249 1backgroundcolorrgba255popover2070100914popoverdataplacementbottom tooltip287621785tpaarrowtop0width12pxheight7pxvideochadochef0 0stainless757575 solidborderradius3pxcolorffflineheight20pxfontfamilyhelveticaneuew0145lighhelveticaneuew0245lighhelveticaneuew1045lighhelveticasteel extractor systemnormal normal 15px14emneue2934 206015px14em nimbussanstw01consansseriftextdecoration1lrycdivmargin0gasimagebutton1defaultimagepopover2070100914popoverdataplacementlefttooltip287621785popoveranimationenteropacity0transformscale9 translatex10px32bhmi5uthover14px1 nimbussanstw01consansseriftextdecoration compj3oezpdnfireplace110 204680plural 0 nofireplaces homeneuehelveticaarialmeiryo pro w3hiraginopopover2070100914popoverdataplacementleftchef6046imagebutton1activeimagecomplete20px15em nimbussanstw01consansseriftextdecoration compj3oezpdn20px15em nimbussanstw01consansseriftextdecoration2zthnnormal 15px14emultxtnewsteel gas braaispaddingleft17pxulafrican manufactured stainlessversatile you candrawersouth0 07compj3oezpdnwatch14px144em nimbussanstw01consansseriftextdecoration compj3oezpdnburningdelicious beefchickenstylek8fj46zlnavcontainerarrowstylek8fj46zlnavcontainerrightdirection0s backgroundcolor 04s3s9hz 2sx5lpositionfixed importantleftauto2s easeinoutcoloroutblack mirror flameline11divdatahookwixvodwidgetdirectioncontainerdirrtlmadefirecount1valuegasfirecount1valueprego steakcount1valueshadow chefcount1valueuniversalvideoscontainermax7992033779am2rnfontsize14pxmargintop5pxfontfamilyhelveticagothic366ewstylek8fj46zlnavcontainerarrowstylek8fj46zlnavcontainerleftdirectionselectdatapreviewhover24px133emline fireplacedelicious lasagnegratecount1valuewood burning2s easeinoutbordercolor 2stransitioncolor1divdataplayablehookplayercontainerdataplayableminwidth579pxcolorpickeritem459055545radioouterboxshadow0 0prego steaksteel gas braaiyoucounter2727760664inputwrapperflexgrow1importantprego steaksselectdataerrortruehybrid3cglyph0px20 70 29nimbussanstw01consansseriffontnormalgrill extractor1bordercolorrgba0braai ember0 rgba000120 0rgba0 0 0inputwebkitinnerspinbuttonwebkitappearancenonemargin0ovencount1valuepotjiecount1valueroastcount1valuebomacount1valuebomadropdown294681846dropdowndropdown1750531977contentvisible dropdownbase207754212rootcompj3oezpdn dropdownoption978924491dropdownoptionsec4px 0hasflueless gas fireplaceschefcount1valuechado chefcount1valuechadochefcount1valuechicken wingscount1valuefirecolor000000dropdown294681846dropdown dropdownbase207754212rootcompj3oezpdn dropdownoption978924491dropdownoption1bordersolid rgba0ultxtnew ol18px14emsubscribedropdown294681846dropdown dropdown1750531977dropdowncontent16pxcompj3oezpdn4px 0 rgba00010 0 07compj3oezpdn2dropin fireplaceeventspublisherchadochef lifestylebraai stainless steelshowsystemsmarginleftup20pxcompj9xxdo65nearly anythingsteakseaseinoutbordercolorwingscount1valuefireborderwidth2px20px14em1rv4upassword06fontnormal normal normaldropdownbase207754212rootcompj3oezpdn dropdownoption978924491dropdownoption dropdown294681846dropdowncalc1009 77 29marginleft calc100 980pxprosansseriffontsize14pxwebkitfontsmoothingautoboxshadow0wingscount1valuefire gratecount1valuefireplacecount1valueflamescount1valuegas firecount1valuegasfirecount1valueprego2ddgw slickdots linormal 12px14emchefchadw3hiraginocanpopover2070100914popovercontentbackgroundcolorf64d43border1px5chefcount1valuechadochefcount1valuechickenkaku gothic prosansseriffontsize14pxwebkitfontsmoothingautoboxshadow014px14emso versatileeventstagscount1valueal frescocount1valuealfrescocount1valueboma braaicount1valuechadochefcount1valueflamelinecount1valueflamescount1valuelesagnecount1valuenomadiqcount1valuepizzaburning ovencount1valuewood burningbbq120ms cubicbezier25464594transformscale1 translatey0110 29chad opopover2070100914popoverdataplacementrighttooltip287621785popoveranimationenteropacity0transformscale9 translatex10pxvideo255 255 07compj3oezpdn0 1px03compj3oezpdn07bordercolorrgba0 050backgroundsize100mirror0 779 11029255 255 1arial29 40ember drawerprego steak burgers0 1stylek8fj46zlnavcontainersvgcontainertransparent transparent1inscfontsize75px important34 46 60nimbussanstw01consansserifcompj3oezpdnolvideo to findslickdots042compj3oezpdn255 255ovencount1valuepizza ovencount1valuepotjiecount1valueroastcount1valuebomacount1valueboma braaicount1valuebraaicount1valueburgerscount1valuechadol ulchefcount1valuechadochefcount1valuechicken wingscount1valuefire gratecount1valuefireplacecount1valueflamescount1valuegasovencount1valuewood burning pizzawood burning204 20417px14em0 0compj9xxdo65frescopizza ovenwood burningpathfillf64d432scounter2727760664btn pathfill000000compj3oezpdncolorpicker3740739116item1inscfontsize80pxcolor fffffffont normalresults0 0 042compj3oezpdn77 29 11016linearapplyopacityvideopublishedts1597671395statenullcustomcoverurlnullmediatypesecurevideotrailerinfonullsubscriptiononlyfalsemediaexternurlnullfeatureditemnullstatsinfocategoriescount1valuetravel eventstagscount1valueal0compj9xxdo65hybrid braaidropdownbase207754212root1inscfontsize60px importantbraaicount1valuechadochefcount1valueflamelinecount1valueflamescount1valuelesagnecount1valuenomadiqcount1valuepizzafireplaces household heatingbraais gasrgba2552552552580mscompj3oezpdndivdataplayablehookplayercontainerdataplayabledataplayableinfullscreentrue 2sx5l0 06borderwidth1pxcompj3oezpdnheatingcooked chicken wingspopover2070100914popoverdataplacementtooltip287621785popoveranimationexittooltip287621785popoveranimationexitactiveopacity0transitiontransform 80mswingsonly hybridallimagebutton1hoverimage1backgroundcolorrgba255 255 2550 16pxcompj3oezpdnbuttonnext3636878588contentmargin0nomadiq bbqchefcount1valuechadobuttonnext3636878588contentmargin0 autotextoverflowellipsiswhitespacenowrapoverflowhiddennimbussanstw01consansserifmargin0lineheightnormalletterspacingnormalnimbussanstw01consansseriffontnormal normal normalyou knowmodern fireplace fluelessinputtypenumbermozappearancetextfieldhome of south20 342sx5l779 11029 342028px1000compj9xxdo6507colorrgba0 0 0manufactured stainlessstylek8fj46zlnavcontainerarrowstylek8fj46zlnavcontainercenterdirectionwordwrapbreakwordmaxwidth206pxcolor174165normal normal 17px14emhelveticaneuew0155romanormal 20px15emdirrtlmodern fireplacereset yournormal 14px14emquantitycounter1985873316quantitycounterquantitycounter1985873316customizedeaseinoutbordercolor 2spro w3hiraginoonce297012px14em nimbussanstw01consansserifcompj3oezpdn dropdown294681846rootdropdown294681846mobilesteakcounter2727760664btnbackground0 0padding6pxborder0cursorpointertooltip287621785tpaarrowbottom0width12pxheight7px0linearapplyopacity 80ms linearafrican manufactured8255 1 stylek8fj46zlnavcontainerreturn3s9hz 30tbh 2mzyqhi50hovergothic prosansseriffontsize14pxwebkitfontsmoothingautoboxshadow0 4px980px20px 0chad o chef80 33ember112 909110 293434 462zthn2yocq16px14em80ms linear29 40 0neuehelveticaarialmeiryo pro6stylek8fj46zlnavcontainerleftdirectionpositionstaticboxshadow000 0 0urlhttpsstaticwixstaticcomufonts312c760e2157d715de4c44a75417aef3b136e0woff2filewoff2braaisopacity0 imagebutton1datastatepressedpositionstaticboxshadow000actioncardhover 366ewborderwidth2px borderstylesolidbordercolorrgba249110 29 40divdataplayablehookplayercontainerdataplayableminwidth579px 2sx5lvideopublishedts1597671395statenullcustomcoverurlnullmediatypesecurevideotrailerinfonullsubscriptiononlyfalsemediaexternurlnullfeatureditemnullstatsinfocategoriescount1valuetravel eventstagscount1valueal frescocount1valuealfrescocount1valuebomapositionfixedchefshadowifpopover2070100914popoverdataplacementlefttooltip287621785popoveranimationenteropacity0transformscale952untilproquality gastranslatey0 translatex0marginleft calc100fireplaces southnimbussanstw01consansserifcompj3oezpdn dropdown294681846rootdropdown294681846mobile37a1c13whnormal 14px144em07bordercolorrgba0 0 016px15em nimbussanstw01consansserifcompj3oezpdnbackgroundcolorrgba204 2043qka1padding00 4px 0al frescoprosansseriffontsize14pxwebkitfontsmoothingautoboxshadow0 4px 8px2060 4680normal 20px15em nimbussanstw01consansseriftextdecorationtooltip287621785tpaarrow pathfillf64d43great204 204 1bordersolidimportantleftauto0 4006fontnormalcubicbezier25464594applyopacity 120ms cubicbezier25464594transformscale1backgroundcolorrgba0 0helveticaneuew0255roma5pxfirstbraai stainlessautocompj9xxdo65helveticaneuew0255roma helveticaneuew1055romainputwebkitouterspinbuttontranslatex10px1nvsznimbussanstw01consansseriftextdecorationchefcount1valuechadochefcount1valuechicken wingscount1valuefire1bordercolorrgba0 0 0inputbackgroundffffffcolor000000fontnormal normal normal16px15em nimbussanstw01consansseriftextdecorationplural 0gas braaiswfont312c760e2157d715de4c44a75417aef3b136e0wf0e2157d715de4c44a75417aeforigfreestylescripttextdecoration compj3oezpdn

Longtail Keyword Density for Chad-o-chef.co.za

KeywordsOccurences
margin-left calc100 980px26
calc100 980px 0526
rgba0 0 021
0 0 06fontnormal16
0 06fontnormal normal16
06fontnormal normal normal16
normal normal normal14
04s ease 0s12
0 0 112
font normal normal11
normal normal 14px14em11
normal normal 16px15em11
fresco pizza oven10
0 0 03comp-j3oezpdn10
normal normal 15px14em10
normal 15px14em nimbus-sans-tw01consans-seriftext-decoration10
15px14em nimbus-sans-tw01consans-seriftext-decoration comp-j3oezpdn10
0 0 06comp-j3oezpdn9
16px1 nimbus-sans-tw01consans-seriftext-decoration comp-j3oezpdn9
normal normal 12px14em9
normal 16px1 nimbus-sans-tw01consans-seriftext-decoration9
normal normal 16px19
normal 14px20px nimbus-sans-tw01consans-serifcomp-j3oezpdn8
normal normal 14px20px8
normal 12px14em nimbus-sans-tw01consans-serifcomp-j3oezpdn8
16px15em nimbus-sans-tw01consans-seriftext-decoration comp-j3oezpdn8
normal 14px14em nimbus-sans-tw01consans-serifcomp-j3oezpdn8
0 0 08
normal 16px15em nimbus-sans-tw01consans-seriftext-decoration8
normal normal 17px14em8
flueless gas fireplaces7
12px14em nimbus-sans-tw01consans-serifcomp-j3oezpdn dropdown294681846rootdropdown294681846--mobile7
0 0 07comp-j3oezpdn7
stainless steel gas7
hybrid braai ember7
07border-colorrgba0 0 07
chefcount1valueuniversal gratecount1valuewood burning6
solid rgba0 06
gratecount1valuewood burning ovencount1valuewood6
steakcount1valueshadow chefcount1valueuniversal gratecount1valuewood6
wingscount1valuefire gratecount1valuefireplacecount1valueflamescount1valuegas firecount1valuegasfirecount1valueprego6
firecount1valuegasfirecount1valueprego steakcount1valueshadow chefcount1valueuniversal6
gratecount1valuefireplacecount1valueflamescount1valuegas firecount1valuegasfirecount1valueprego steakcount1valueshadow6
burning ovencount1valuewood burning6
14px1 nimbus-sans-tw01consans-seriftext-decoration comp-j3oezpdn6
normal 14px1 nimbus-sans-tw01consans-seriftext-decoration6
normal normal 14px16
ovencount1valuewood burning pizza6
2ddgw slick-dots li6
ovencount1valuepotjiecount1valueroastcount1valuebomacount1valueboma braaicount1valuebraaicount1valueburgerscount1valuechad o6
ovencount1valuepizza ovencount1valuepotjiecount1valueroastcount1valuebomacount1valueboma braaicount1valuebraaicount1valueburgerscount1valuechad6
o chefcount1valuechado chefcount1valuechadochefcount1valuechicken6
braaicount1valuechad-o-chefcount1valueflamelinecount1valueflamescount1valuelesagnecount1valuenomadiqcount1valuepizza ovencount1valuepizza ovencount1valuepotjiecount1valueroastcount1valuebomacount1valueboma6
frescocount1valuealfrescocount1valueboma braaicount1valuechad-o-chefcount1valueflamelinecount1valueflamescount1valuelesagnecount1valuenomadiqcount1valuepizza ovencount1valuepizza6
braaicount1valuebraaicount1valueburgerscount1valuechad o chefcount1valuechado6
eventstagscount1valueal frescocount1valuealfrescocount1valueboma braaicount1valuechad-o-chefcount1valueflamelinecount1valueflamescount1valuelesagnecount1valuenomadiqcount1valuepizza6
videopublishedts1597671395statenullcustomcoverurlnullmediatypesecurevideotrailerinfonullsubscriptiononlyfalsemediaexternurlnullfeatureditemnullstatsinfocategoriescount1valuetravel eventstagscount1valueal frescocount1valuealfrescocount1valueboma6
255 255 16
normal normal 16px14em6
1bordersolid rgba0 06
chefcount1valuechado chefcount1valuechadochefcount1valuechicken wingscount1valuefire6
chefcount1valuechadochefcount1valuechicken wingscount1valuefire gratecount1valuefireplacecount1valueflamescount1valuegas6
watch this video5
0 0 1px5
positionstaticbox-shadow000 0 05
al fresco pizza5
nimbus-sans-tw01consans-seriftext-decoration comp-j3oezpdn dropdownoption2205199676rootnotdropdownoption2205199676--selectable5
0 0 07border-colorrgba05
0 07border-colorrgba0 05
ease-in-outborder-color 2s ease-in-outcolor4
4px 8px 04
07colorrgba255 255 2554
255 255 07comp-j3oezpdn4
2s ease-in-outcolor 2s4
255 07colorrgba0 04
normal normal 24px133em4
4px 0 rgba00014
0 4px 04
255 255 07colorrgba04
grill extractor systems4
07colorrgba0 0 04
africas only hybrid4
your payment has4
email when your4
receive a confirmation4
up to watch4
channel has no4
plural 0 no4
frescopizza ovenwood burning4
gas fireplaces south4
braais gas fireplaces4
gas braais gas4
quality gas braais4
south africas only4
0 0 06border-width1pxcomp-j3oezpdn4
home of south4
gas fireplaces home4
systems and flueless4
kitchen grill extractor4
braais kitchen grill4
gas braais kitchen4
steel gas braais4
manufactured stainless steel4
african manufactured stainless4
colorpickeritem459055545radioouterbox-shadow0 0 04
0 0 042comp-j3oezpdn4
2s ease-in-outborder-color 2s4
payment has been4
249 1background-colorrgba255 2554
pizza oven beef4
border-width2px border-stylesolidborder-colorrgba249 2494
border-stylesolidborder-colorrgba249 249 2494
249 249 1background-colorrgba2554
line fireplace black4
prego steak burgers4
flame line fireplace4
chad o chef4
255 1 style-k8fj46zlnavcontainer4
1background-colorrgba255 255 2554
equipped to make3
braai is perfectly3
oven wood burning3
video to find3
lasagne was made3
made in our3
our al fresco3
pizza oven wood3
make potjies watch3
40 0 77-93
shot of our3
cooked chicken wings3
0 rgba0 03
delicious beef roast3
0 1px rgba03
1px rgba0 03
inputbackgroundffffffcolor000000fontnormal normal normal3
normal 16px15em nimbus-sans-tw01consans-serifcomp-j3oezpdn3
chad-o-chef picture fireplace3
braai ember drawer3
steel gas braai3
chad-o-chef hybrid braai3
dropdownoption978924491dropdownoption dropdown294681846dropdown dropdownbase207754212rootcomp-j3oezpdn3
dropdown294681846dropdown dropdownbase207754212rootcomp-j3oezpdn dropdownoption978924491dropdownoption3
dropdownbase207754212rootcomp-j3oezpdn dropdownoption978924491dropdownoption dropdown294681846dropdown3
dropdownoption978924491dropdownoption dropdown294681846dropdowndropdown1750531977--content-visible dropdownbase207754212rootcomp-j3oezpdn3
dropdown294681846dropdowndropdown1750531977--content-visible dropdownbase207754212rootcomp-j3oezpdn dropdownoption978924491dropdownoption3
black mirror flameline3
our black mirror3
braai stainless steel3
gas braai stainless3
border-radius0 positionabsolutetop0right0bottom0left0transitionborder-color 04s3
transitioncolor 04s ease3
normal normal 20px14em3
background-color 04s ease3
0s background-color 04s3
ease 0s background-color3
positionabsolutetop0right0bottom0left0transitionborder-color 04s ease3
helvetica arial sans-serifline-height1433
1border-colorrgba0 0 03
helveticaneuew10-55roma helvetica arial3
helveticaneuew02-55roma helveticaneuew10-55roma helvetica3
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma3
neue helveticaneuew01-55roma helveticaneuew02-55roma3
font-size14pxmargin-top5pxfont-familyhelvetica neue helveticaneuew01-55roma3
positionfixed importantleftauto importantz-index503
normal normal 80px14em3
background-colorrgba0 0 03
background-colorrgba204 204 2043
roast was cooked3
gas grill modern3
stainless steel extractor3
steel extractor system3
extractor system kitchen3
system kitchen extractor3
kitchen extractor gas3
extractor gas grill3
grill modern fireplace3
204 204 1bordersolid3
modern fireplace flueless3
fireplace flueless gas3
gas fireplaces household3
fireplaces household heating3
background-colorrgba255 255 2553
0 0 063
204 1bordersolid rgba03
0 0 rgba03
cooked to perfection3
0 77-9 110-293
80 80 333
prosans-seriffont-size14px-webkit-font-smoothingautobox-shadow0 4px 8px3
20 70 293
33 20 703
0 rgba000120 03
rgba000120 0 4px3
80 33 203
popover2070100914popoverdata-placementtooltip287621785popoveranimation-entertooltip287621785popoveranimation-enter-activeopacity1transitiontransform 120ms cubic-bezier25464594applyopacity3
kaku gothic prosans-seriffont-size14px-webkit-font-smoothingautobox-shadow03
120ms cubic-bezier25464594applyopacity 120ms3
cubic-bezier25464594applyopacity 120ms cubic-bezier25464594transformscale13
120ms cubic-bezier25464594transformscale1 translatey03
cubic-bezier25464594transformscale1 translatey0 translatex03
popover2070100914popoverdata-placementtooltip287621785popoveranimation-exitopacity1transformscale1 translatey0 translatex03
popover2070100914popoverdata-placementtooltip287621785popoveranimation-exittooltip287621785popoveranimation-exit-activeopacity0transitiontransform 80ms linearapplyopacity3
80ms linearapplyopacity 80ms3
gothic prosans-seriffont-size14px-webkit-font-smoothingautobox-shadow0 4px3
w3hiragino kaku gothic3
popover2070100914popovercontentbackground-colorf64d43border1px solid rgba255255255253
29 40 03
77-9 110-29 34-203
110-29 34-20 60-463
34-20 60-46 80-803
60-46 80-80 20-333
80-80 20-33 29-703
20-33 29-70 29-110z3e3
29-70 29-110z3e 3cglyph3
110 29 403
pro w3hiragino kaku3
29 110 293
70 29 1103
popover2070100914popovercontentbackground-color212121padding4px 12pxborder1px 7575753
12pxborder1px 757575 solidborder-radius3pxcolorfffline-height20pxfont-familyhelveticaneuew01-45lighhelveticaneuew02-45lighhelveticaneuew10-45lighhelvetica3
757575 solidborder-radius3pxcolorfffline-height20pxfont-familyhelveticaneuew01-45lighhelveticaneuew02-45lighhelveticaneuew10-45lighhelvetica neuehelveticaarialmeiryo3
solidborder-radius3pxcolorfffline-height20pxfont-familyhelveticaneuew01-45lighhelveticaneuew02-45lighhelveticaneuew10-45lighhelvetica neuehelveticaarialmeiryo pro3
neuehelveticaarialmeiryo pro w3hiragino3
linearapplyopacity 80ms linear3
60 80 803
alfresco pizza oven3
0-77 9-110 29-343
70-29 110 03
33-29 70-29 1103
80-20 33-29 70-293
46-80 80-20 33-293
20-60 46-80 80-203
29-34 20-60 46-803
9-110 29-34 20-603
3s9hz 30tbh 2mzy3
normal 20px15em nimbus-sans-tw01consans-seriftext-decoration3
cook nearly anything3
can cook nearly3
you can cook3
versatile you can3
so versatile you3
oven is so3
oven this oven3
20px15em nimbus-sans-tw01consans-seriftext-decoration comp-j3oezpdn3
normal normal 20px15em3
nimbus-sans-tw01consans-seriffontnormal normal normal3
9 77 293
normal 16px14em nimbus-sans-tw01consans-seriftext-decoration3
46 60 803
34 46 603
20 34 463
110 20 343
29 110 203
77 29 1103
40 9 773
14px144em nimbus-sans-tw01consans-seriftext-decoration comp-j3oezpdn3
0 40 93
110 0 403
normal normal 14px143em3
normal 14px143em nimbus-sans-tw01consans-seriftext-decoration3
14px143em nimbus-sans-tw01consans-seriftext-decoration comp-j3oezpdn3
normal normal 14px144em3
normal 14px144em nimbus-sans-tw01consans-seriftext-decoration3
8px 0 rgba0001203
normal normal133
0 0117
nimbus-sans-tw01consans-seriftext-decoration comp-j3oezpdn54
1px 16pxcomp-j3oezpdn36
calc100 980px26
980px 0526
margin-left calc10026
255 25525
rgba0 021
pizza oven19
ease 0s16
06fontnormal normal16
0 06fontnormal16
eventspublisherchad-o-chef lifestyle16
boma braai15
0 16pxcomp-j3oezpdn14
fresco pizza13
0 112
04s ease12
font normal11
normal 16px15em11
gas fireplaces11
normal 14px14em11
burning pizza10
stainless steel10
normal 15px14em10
15px14em nimbus-sans-tw01consans-seriftext-decoration10
dropdownoption978924491dropdownoption dropdown294681846dropdown10
0 03comp-j3oezpdn10
normal 16px19
16px1 nimbus-sans-tw01consans-seriftext-decoration9
0 06comp-j3oezpdn9
normal 12px14em9
16px15em nimbus-sans-tw01consans-seriftext-decoration8
2ddgw slick-dots8
gas braais8
14px14em nimbus-sans-tw01consans-serifcomp-j3oezpdn8
12px14em nimbus-sans-tw01consans-serifcomp-j3oezpdn8
normal 14px20px8
14px20px nimbus-sans-tw01consans-serifcomp-j3oezpdn8
full screen8
normal 17px14em8
picture fireplace7
braai ember7
07border-colorrgba0 07
flueless gas7
margin0line-heightnormalletter-spacingnormal txtnew7
112 907
0 07comp-j3oezpdn7
steel gas7
comp-j3oezpdn dropdownoption2205199676rootnotdropdownoption2205199676--selectable7
padding-top calc1007
nimbus-sans-tw01consans-serifcomp-j3oezpdn dropdown294681846rootdropdown294681846--mobile7
3s9hz 30tbh7
hybrid braai7
braaicount1valuechad-o-chefcount1valueflamelinecount1valueflamescount1valuelesagnecount1valuenomadiqcount1valuepizza ovencount1valuepizza6
ovencount1valuepizza ovencount1valuepotjiecount1valueroastcount1valuebomacount1valueboma6
ovencount1valuepotjiecount1valueroastcount1valuebomacount1valueboma braaicount1valuebraaicount1valueburgerscount1valuechad6
braaicount1valuebraaicount1valueburgerscount1valuechad o6
solid rgba06
eventstagscount1valueal frescocount1valuealfrescocount1valueboma6
videopublishedts1597671395statenullcustomcoverurlnullmediatypesecurevideotrailerinfonullsubscriptiononlyfalsemediaexternurlnullfeatureditemnullstatsinfocategoriescount1valuetravel eventstagscount1valueal6
255 16
normal 14px16
14px1 nimbus-sans-tw01consans-seriftext-decoration6
0px 16pxcomp-j3oezpdn6
chefcount1valuechado chefcount1valuechadochefcount1valuechicken6
slick-dots li6
normal 16px14em6
divdata-playable-hookplayer-containerdata-playable-min-width579px 2sx5l6
dropdownbase207754212rootcomp-j3oezpdn dropdownoption978924491dropdownoption6
3s9hz 2sx5l6
o chefcount1valuechado6
frescocount1valuealfrescocount1valueboma braaicount1valuechad-o-chefcount1valueflamelinecount1valueflamescount1valuelesagnecount1valuenomadiqcount1valuepizza6
chefcount1valuechadochefcount1valuechicken wingscount1valuefire6
ovencount1valuewood burning6
204 2046
your payment6
29 1106
translatey0 translatex06
1bordersolid rgba06
wingscount1valuefire gratecount1valuefireplacecount1valueflamescount1valuegas6
0 1px6
1inscfont-size60px important6
complete your6
steakcount1valueshadow chefcount1valueuniversal6
burning ovencount1valuewood6
gratecount1valuefireplacecount1valueflamescount1valuegas firecount1valuegasfirecount1valueprego6
firecount1valuegasfirecount1valueprego steakcount1valueshadow6
gratecount1valuewood burning6
chefcount1valueuniversal gratecount1valuewood6
0 07border-colorrgba05
dropdown294681846dropdown dropdown1750531977dropdowncontent5
1s linear5
you can5
1 style-k8fj46zlnavcontainer5
prego steak5
fireplace black5
chicken wings5
positionstaticbox-shadow000 05
dirrtl 2ddgw5
al fresco5
nimbus-sans-tw01consans-serif color0000005
ease-in-outborder-color 2s4
2s ease-in-outcolor4
255 07comp-j3oezpdn4
colorpickeritem459055545radioouterbox-shadow0 04
07colorrgba255 2554
ease-in-outcolor 2s4
buttonnext3636878588contentmargin0 autotext-overflowellipsiswhite-spacenowrapoverflowhidden4
txtnew ul4
0 06border-width1pxcomp-j3oezpdn4
4px 8px4
8px 04
wfont312c760e2157d715de4c44a75417aef3b136e0wf0e2157d715de4c44a75417aeforigfreestylescripttext-decoration comp-j3oezpdn4
0 4px4
4px 04
normal 24px133em4
255 07colorrgba04
07colorrgba0 04
0 042comp-j3oezpdn4
2s ease-in-outborder-color4
south africas4
background-color ffffff4
ovenwood burning4
has been4
payment has4
confirmation email4
youll receive4
once your4
only take4
reset your4
channel videos4
has no4
channel has4
1 14
0 no4
plural 04
have access4
frescopizza ovenwood4
color ffffff4
extractor systems4
dropdownoption978924491dropdownoption dropdown294681846dropdowndropdown1750531977--content-visible4
african manufactured4
manufactured stainless4
braais kitchen4
kitchen grill4
grill extractor4
fireplaces home4
chefchad o4
africas only4
only hybrid4
quality gas4
braais gas4
fireplaces south4
gas braai4
transparent transparent4
0 rgba00014
20px 04
30tbh 2mzy4
10px 04
32px 04
bbq chicken4
oven wood4
wood burning4
shadow chef4
chado chef4
o chef4
chad o4
flame line4
1inscfont-size80px important4
line fireplace4
oven beef4
249 2494
2zthn 3rqkm4
prego steaks4
steak burgers4
border-stylesolidborder-colorrgba249 2494
border-width2px border-stylesolidborder-colorrgba2494
249 1background-colorrgba2554
1background-colorrgba255 2554
so versatile3
alfresco pizza3
normal 80px14em3
chad-o-chef picture3
delicious beef3
versatile you3
can cook3
cook nearly3
nearly anything3
outdoor firepit3
nomadiq bbq3
beef roast3
110 293
drop-in fireplace3
importantleftauto importantz-index503
divdata-playable-hookplayer-containerdata-playable-min-width579px 1dini3
1px rgba03
counter2727760664btn pathfill000000comp-j3oezpdn3
inputbackgroundffffffcolor000000fontnormal normal3
16px15em nimbus-sans-tw01consans-serifcomp-j3oezpdn3
3gbol pfpc5displaynonecomp-j9xxdo653
positionfixed importantleftauto3
dropdownoption2205199676titlecomp-j3oezpdn dropdownoption978924491dropdownoption3
action-cardhover 366ew3
0 0comp-j9xxdo653
dropdown294681846dropdown dropdownbase207754212rootcomp-j3oezpdn3
28px 10px3
0 rgba0005comp-j9xxdo653
dropdown294681846dropdowndropdown1750531977--content-visible dropdownbase207754212rootcomp-j3oezpdn3
cooked chicken3
kitchen extractor3
ember drawer3
1inscfont-size75px important3
make potjies3
perfectly equipped3
you know3
background-color 04s3
chef chadochef3
fontnormal normal3
normal 20px14em3
transitioncolor 04s3
find out3
background-colorrgba0 03
selectdata-previewerror style-k8fj46zlnavcontainerarrow3
style-k8fj46zlnavcontainerarrow style-k8fj46zlnavcontainersvgcontainer3
opacity0 imagebutton1data-statepressed3
background-colorrgba255 2553
0 063
204 1bordersolid3
potjies watch3
0s background-color3
chad-o-chef hybrid3
gas grill3
mirror flameline3
braai stainless3
steel extractor3
extractor system3
system kitchen3
divdata-playable-hookplayer-containerdata-playable-data-playable-in-full-screentrue 3gbol3
extractor gas3
grill modern3
delicious lasagne3
modern fireplace3
fireplace flueless3
fireplaces household3
household heating3
black mirror3
our black3
great shot3
our al3
0 rgba03
divdata-playable-hookplayer-containerdata-playable-data-playable-in-full-screentrue 2sx5l3
ultxtnew ol3
20 343
w3hiragino kaku3
kaku gothic3
gothic prosans-seriffont-size14px-webkit-font-smoothingautobox-shadow03
prosans-seriffont-size14px-webkit-font-smoothingautobox-shadow0 4px3
46 603
34 463
0 rgba0001203
rgba000120 03
110 203
neuehelveticaarialmeiryo pro3
background-colorrgba204 2043
tooltip287621785tpaarrow svgdisplayblock3
popover2070100914popoverdata-placementtop tooltip287621785tpaarrowbottom0width12pxheight7px3
popover2070100914popoverdata-placementbottom tooltip287621785tpaarrowtop0width12pxheight7px3
popover2070100914popoverdata-placementleft tooltip287621785tpaarrowright0width7pxheight12px3
popover2070100914popoverdata-placementright tooltip287621785tpaarrowleft0width7pxheight12px3
popover2070100914popoverdata-placementtoptooltip287621785popoveranimation-enteropacity0transformscale9 translatey3px3
popover2070100914popoverdata-placementbottomtooltip287621785popoveranimation-enteropacity0transformscale9 translatey-3px3
popover2070100914popoverdata-placementlefttooltip287621785popoveranimation-enteropacity0transformscale9 translatex10px3
pro w3hiragino3
solidborder-radius3pxcolorfffline-height20pxfont-familyhelveticaneuew01-45lighhelveticaneuew02-45lighhelveticaneuew10-45lighhelvetica neuehelveticaarialmeiryo3
popover2070100914popoverdata-placementtooltip287621785popoveranimation-entertooltip287621785popoveranimation-enter-activeopacity1transitiontransform 120ms3
29-110z3e 3cglyph3
40 03
0 77-93
77-9 110-293
110-29 34-203
34-20 60-463
60-46 80-803
80-80 20-333
20-33 29-703
29-70 29-110z3e3
positionabsolutetop0right0bottom0left0transitionborder-color 04s3
757575 solidborder-radius3pxcolorfffline-height20pxfont-familyhelveticaneuew01-45lighhelveticaneuew02-45lighhelveticaneuew10-45lighhelvetica3
70 293
20 703
border-radius0 positionabsolutetop0right0bottom0left0transitionborder-color3
33 203
80 333
80 803
60 803
popover2070100914popovercontentbackground-color212121padding4px 12pxborder1px3
12pxborder1px 7575753
popover2070100914popoverdata-placementrighttooltip287621785popoveranimation-enteropacity0transformscale9 translatex-10px3
120ms cubic-bezier25464594applyopacity3
29 403
helveticaneuew02-55roma helveticaneuew10-55roma3
80-20 33-293
normal 14px143em3
14px143em nimbus-sans-tw01consans-seriftext-decoration3
normal 14px144em3
14px144em nimbus-sans-tw01consans-seriftext-decoration3
normal 20px15em3
20px15em nimbus-sans-tw01consans-seriftext-decoration3
46-80 80-203
20-60 46-803
29-34 20-603
70-29 1103
helveticaneuew01-55roma helveticaneuew02-55roma3
neue helveticaneuew01-55roma3
font-size14pxmargin-top5pxfont-familyhelvetica neue3
9-110 29-343
0-77 9-1103
0 5-23
1nvsz 2ddgw3
50background-size100 1000comp-j9xxdo653
ol ul3
33-29 70-293
110 03
cubic-bezier25464594applyopacity 120ms3
solid rgba255255255253
120ms cubic-bezier25464594transformscale13
cubic-bezier25464594transformscale1 translatey03
77 293
popover2070100914popoverdata-placementtooltip287621785popoveranimation-exitopacity1transformscale1 translatey03
popover2070100914popoverdata-placementtooltip287621785popoveranimation-exittooltip287621785popoveranimation-exit-activeopacity0transitiontransform 80ms3
80ms linearapplyopacity3
linearapplyopacity 80ms3
80ms linear3
popover2070100914popovercontentbackground-colorf64d43border1px solid3
tooltip287621785tpaarrow pathfillf64d433
0 403
counter2727760664btnbackground0 0padding6pxborder0cursorpointer3
div padding-left17px3
nimbus-sans-tw01consans-seriffontnormal normal3
16px14em nimbus-sans-tw01consans-seriftext-decoration3
9 773
40 93
arial sans-serifline-height1433
helvetica arial3
helveticaneuew10-55roma helvetica3
1border-colorrgba0 03
0315
normal254
nimbus-sans-tw01consans-seriftext-decoration61
comp-j3oezpdn60
2ddgw57
16pxcomp-j3oezpdn56
150
1px48
background-color39
color36
calc10033
important33
232
pizza32
fieldsetdisabled31
your30
gas29
braai28
nimbus-sans-tw01consans-serifcomp-j3oezpdn27
video27
margin-left26
solid26
980px26
0526
3s9hz24
oven24
16px23
you22
boma22
rgba021
2sx5l21
dropdownoption978924491dropdownoption20
dropdownerror168152165root20
burning20
videos20
dropdownnativeselect2882533990erroricon20
divdata-playable-hookplayer-containerdata-playable-min-width579px20
divdata-hookwix-vod-widget-direction-containerdirrtl19
divdata-hookwix-vod-widget-direction-containerdirltr19
fireplace19
txtnew18
channel18
dropdown294681846dropdown18
divdata-playable-hookplayer-containerdata-playable-data-playable-in-full-screentrue18
0s17
ease17
o16
eventspublisherchad-o-chef16
lifestyle16
tooltip287621785root16
06fontnormal16
2s14
fresco14
30tbh14
quantitycounter1985873316quantitycounterquantitycounter1985873316--customized13
hybrid13
have13
style-k8fj46zlnavcontainer13
2zthn13
04s12
chef12
up12
312
color00000012
412
2px12
07comp-j3oezpdn12
style-k8fj46zlnavcontainerarrow11
16px15em11
4px11
transparent11
03comp-j3oezpdn11
14px14em11
positionabsolutetop0right0bottom0left011
data-focus-sourcekey11
fireplaces11
font11
511
quantitycounter1985873316quantitycounter11
new11
06comp-j3oezpdn10
10px10
15px14em10
prego10
available10
ul10
our10
extractor10
stainless10
steel10
linear10
divdata-playable-hookplayer-containerdata-playable-max-width1900px9
69
79
12px14em9
chicken9
89
16px19
3tstq9
nimbus-sans-tw01consans-serif9
black9
watch9
99
email8
ffffff8
payment8
youll8
bbq8
5px8
slick-dots8
17px14em8
screen8
only8
south8
full8
dropdownoption2205199676rootnotdropdownoption2205199676--selectable8
3uack8
grill8
no8
braais8
3gbol8
complete8
dropdown294681846rootdropdown294681846--mobile8
0px8
has8
108
14px20px8
ember7
divdata-playable-hookplayer-containerdata-playable-max-width550px7
chad-o-chef7
117
127
2scomp-j9xxdo657
1krbw7
137
beef7
picture7
2zthn2yocq7
var7
dropdown294681846dropdowndropdown1750531977--content-visible7
li7
padding-top7
counter2727760664root7
kitchen7
margin0line-heightnormalletter-spacingnormal7
07border-colorrgba07
ol7
flueless7
chefcount1valuechadochefcount1valuechicken6
chefcount1valuechado6
braaicount1valuebraaicount1valueburgerscount1valuechad6
ovencount1valuepotjiecount1valueroastcount1valuebomacount1valueboma6
wingscount1valuefire6
37a1c6
ovencount1valuepizza6
cooked6
gratecount1valuefireplacecount1valueflamescount1valuegas6
firecount1valuegasfirecount1valueprego6
quality6
chefcount1valueuniversal6
steakcount1valueshadow6
videos-container-max-7996
gratecount1valuewood6
ovencount1valuewood6
access6
6pxcomp-j9xxdo656
islands6
purchase6
action6
signed6
reset6
16px14em6
once6
3s6
3o33d6
style-k8fj46zlnavcontainerarrowstyle-k8fj46zlnavcontainerleft-direction6
delicious6
14px16
1inscfont-size60px6
tooltip287621785tpaarrow6
120ms6
146
translatey06
translatex06
style-k8fj46zlnavcontainerarrowstyle-k8fj46zlnavcontainercenter-direction6
80ms6
156
style-k8fj46zlnavcontainerarrowstyle-k8fj46zlnavcontainerright-direction6
dropdownbase207754212root6
svgcomp-j9xxdo656
colorpicker3740739116item6
dropdownbase207754212rootcomp-j3oezpdn6
eventstagscount1valueal6
eventschad-o-chef6
1bordersolid6
videos-container-max-4496
braaicount1valuechad-o-chefcount1valueflamelinecount1valueflamescount1valuelesagnecount1valuenomadiqcount1valuepizza6
frescocount1valuealfrescocount1valueboma6
3px6
videopublishedts1597671395statenullcustomcoverurlnullmediatypesecurevideotrailerinfonullsubscriptiononlyfalsemediaexternurlnullfeatureditemnullstatsinfocategoriescount1valuetravel6
jp72r5
32bhm-i5uthover5
165
action-cardhover5
gxjux5
3-5se5
-mrb7qo7ejhover5
pfpc55
1dini5
175
max-width599pxcomp-j9xxdo655
185
am2rn5
dirrtl5
dropdown1750531977dropdowncontent5
if5
videos-container-max-5495
imagebutton1hoverimage5
burgers5
imagebutton1defaultimage5
ralewaysans-serif5
flameline5
can5
imagebutton1activeimage5
al5
border05
ultxtnew5
12px5
1s5
steak5
positionstaticbox-shadow0005
wings5
wood5
alfresco5
systems4
ease-in-outborder-color4
home4
ease-in-outcolor4
buttonnext3636878588contentmargin04
style-k8ejjyjblabel4
194
africas4
right4
chefshadow4
chefchad4
border-radius04
buttonnext3636878588contentoverflowvisibletext-overflowunsetwhite-spaceunset4
style-k8ejjyjblink4
frescopizza4
ovenwood4
nomadiq4
chad4
style-k8ejjyjblabelwrapper4
div4
chado4
chadochef4
autotext-overflowellipsiswhite-spacenowrapoverflowhidden4
african4
1inscfont-size80px4
042comp-j3oezpdn4
svg4
0004
24px133em4
wfont312c760e2157d715de4c44a75417aef3b136e0wf0e2157d715de4c44a75417aeforigfreestylescripttext-decoration4
1background-colorrgba2554
7px4
07colorrgba2554
border-stylesolidborder-colorrgba2494
border-width2px4
opacity04
style-k8fj46zlrepeaterbuttonlabel4
07colorrgba04
06border-width1pxcomp-j3oezpdn4
style-j9ph853elabel4
margin04
style-j9ph853elink4
style-j9ph853elabelwrapper4
colorpickeritem459055545radiooutercomp-j3oezpdn4
colorpickeritem459055545radioouterbox-shadow04
style-k8ehupgflabel4
style-k8ehupgflink4
style-k8ehupgflabelwrapper4
coloroption2215770673coloroption4
lb1itemscontainer4
rgba00014
8px4
manufactured4
204
214
roast4
3cglyph4
qhi50hover4
divdata-playable-hookplayer-containerdata-playable-max-width639px4
autocomp-j9xxdo654
224
b0b0b04
so4
results4
embed4
0000004
steaks4
account4
page4
subscribe4
like4
fgolapadding04
line4
3omks4
arial4
1-3wh4
buttoncomp-j9xxdo654
now4
32px4
been4
20px4
0comp-j9xxdo654
confirmation4
receive4
2mzy4
password4
80px14em4
period4
37pxcomp-j9xxdo654
18px14em4
videochad-o-chef4
16pxcomp-j9xxdo654
take4
flame4
7pxcomp-j9xxdo654
franc4
starts4
overflowhidden4
all4
until4
monthly4
shadow4
3rqkm4
other4
sign4
plural4
videos-container-min-8004
text-aligninitialdisplayflexalign-itemscenter3
imagebutton1data-statehovered3
width1003
here3
font-weight5003
word-wrapbreak-wordmax-width206pxcolor1741653
justify-contentcenter3
padding-left17px3
importantz-index503
20px15em3
urlhttpsstaticwixstaticcomufonts312c760e2157d715de4c44a75417aef3b136e0woff2filewoff23
return3
selectdata-previewhover3
selecthover3
style-k8fj46zlnavcontainerleft-direction3
helveticaneuew02-55roma3
style-k8fj46zlnavcontainersvgcontainer3
nimbus-sans-tw01consans-seriffontnormal3
helveticaneuew10-55roma3
imagebutton1data-statepressed3
helvetica3
neue3
font-size14pxmargin-top5pxfont-familyhelvetica3
sans-serifline-height1433
14px143em3
14px144em3
input-ms-cleardisplaynone3
inputbackgroundffffffcolor000000fontnormal3
counter2727760664btn3
positionabsolutetop0right0bottom0left0transitionborder-color3
heating3
background-colorrgba03
household3
0positionrelativewhite-spacenowrap3
modern3
system3
positionfixed3
helveticaneuew01-55roma3
style-k0qkha77bg3
topautobottom03
transitioncolor3
importantleftauto3
20px14em3
fontnormal3
1border-colorrgba03
firepit3
pathfill000000comp-j3oezpdn3
we3
counter2727760664btndisabled3
background-colorrgba2553
justify-contentflex-start3
063
justify-contentflex-end3
dropdownoption2205199676titlecomp-j3oezpdn3
height3
outdoor3
sec3
first3
show3
background-colorrgba2043
oldirrtl3
drop-in3
selectfocus3
jle3h3
inputtypenumber-moz-appearancetextfield3
0-773
2zthn2ahc63
3sc7knotonly-of-typefirst-of-type3
3sc7knotonly-of-typelast-of-type3
3ds0z3
potjies3
make3
equipped3
perfectly3
know3
1nvsz3
fire3
233
5-23
0-53
9-1103
50background-size1003
29-343
20-603
46-803
80-203
33-293
70-293
243
253
263
273
flames3
283
77-93
110-293
1000comp-j9xxdo653
3mnyncomp-j9xxdo653
60-463
1rv4u3
28px3
divdata-playable-hookplayer-containerdata-playable-max-width350px3
1ezun3
2nnoh3
366ew3
2iuvk3
uigmj3
pfpc5displaynonecomp-j9xxdo653
20pxcomp-j9xxdo653
anything3
nearly3
cook3
1lrycdivmargin03
1lryc3
upu13
find3
versatile3
perfection3
27i2r3
3a6qs3
drawer3
mirror3
shot3
great3
3wnybcomp-j9xxdo653
3wnybtransformtranslatez0comp-j9xxdo653
3qka1padding03
made3
lasagne3
out3
34-203
80-803
input-webkit-inner-spin-button-webkit-appearancenonemargin03
linearapplyopacity3
translatey3px3
popover2070100914popoverdata-placementbottomtooltip287621785popoveranimation-enteropacity0transformscale93
translatey-3px3
popover2070100914popoverdata-placementlefttooltip287621785popoveranimation-enteropacity0transformscale93
translatex10px3
popover2070100914popoverdata-placementrighttooltip287621785popoveranimation-enteropacity0transformscale93
translatex-10px3
popover2070100914popoverdata-placementtooltip287621785popoveranimation-entertooltip287621785popoveranimation-enter-activeopacity1transitiontransform3
style-k8fj46zlrepeaterbuttondata-statedrop3
rgba0005comp-j9xxdo653
cubic-bezier25464594transformscale13
popover2070100914popoverdata-placementtooltip287621785popoveranimation-exitopacity1transformscale13
popover2070100914popoverdata-placementtooltip287621785popoveranimation-exittooltip287621785popoveranimation-exit-activeopacity0transitiontransform3
style-k8fj46zlnavcontainercenter-direction3
popover2070100914popovercontentbackground-colorf64d43border1px3
tooltip287621785tpaarrowleft0width7pxheight12px3
rgba255255255253
pathfillf64d433
style-k8fj46zlnavcontainerright-direction3
dropdownbase207754212rootbutton894595444--upgrade3
selectdata-previewerror3
selectdata-errortrue3
counter2727760664btnbackground03
0padding6pxborder0cursorpointer3
counter2727760664btndisabledcursordefault3
svgcolorf64d433
selectdata-previewfocus3
counter2727760664inputwrapperflex-grow13
inputpadding0border0text-aligncenterwidth1003
input-webkit-outer-spin-button3
popover2070100914popoverdata-placementtoptooltip287621785popoveranimation-enteropacity0transformscale93
popover2070100914popoverdata-placementright3
20-333
pro3
29-703
29-110z3e3
293
303
313
323
products3
1inscfont-size75px3
popover2070100914arrowborder-width5px3
popover2070100914popovercontentbackground-color212121padding4px3
12pxborder1px3
333
solidborder-radius3pxcolorfffline-height20pxfont-familyhelveticaneuew01-45lighhelveticaneuew02-45lighhelveticaneuew10-45lighhelvetica3
neuehelveticaarialmeiryo3
w3hiragino3
tooltip287621785tpaarrowright0width7pxheight12px3
popover2070100914popoverdata-placementlefttooltip287621785witharrowpadding-right6px3
popover2070100914popoverdata-placementleft3
tooltip287621785tpaarrowtop0width12pxheight7px3
popover2070100914popoverdata-placementbottom3
tooltip287621785tpaarrowbottom0width12pxheight7px3
popover2070100914popoverdata-placementtop3
popover2070100914popoverdata-placementrighttooltip287621785witharrowpadding-left6px3
popover2070100914popoverdata-placementbottomtooltip287621785witharrowpadding-top6px3
kaku3
popover2070100914popoverdata-placementtoptooltip287621785witharrowpadding-bottom6px3
svgdisplayblock3
tooltip287621785tpaarrowdisplayblockpositionabsolutemargin03
rgba0001203
prosans-seriffont-size14px-webkit-font-smoothingautobox-shadow03
gothic3
cubic-bezier25464594applyopacity3

Who hosts Chad-o-chef.co.za?

Chad-o-chef.co.za Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:GOOGLE
Hosted Country:United StatesUS
Location Latitude:41.2591
Location Longitude:-95.8517
Webserver Software:Not Applicable

Is "GOOGLE" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%

HTTP Header Analysis for Chad-o-chef.co.za

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Wed, 14 Oct 2020 21:48:27 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.chad-o-chef.co.za/
content-language: en
X-Wix-Request-Id: 1602712107.422519686114279229825
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: gv/XVF9HsGpk8A2KWukUzOwfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVhT9gRHUF6iCEZerWBFcnqX,2d58ifebGbosy5xc FRaluJ4 oeH2ktOvatae0CRqHBgiSjJwchVIHSNvDtlMEUAEyJoxwojLzsfJccIH4RZKA==,2UNV7KOq4oGjA5 PKsX47JeSAtYJ4i5JfWbg2xSNjS4=,m0j2EEknGIVUW/liY8BLLox3LFhlpbffVUFbLzszg6o=,1wy2ILu/S4rlWT/R4rqCrevOYhH21aOeLZKA Zso 0g=,WcrWvzU6 v56AFbpVWES8k5kxyemuZnzAzdWUwtffrZGp/J3MBzgzU8QHrQuh4zQ,pglrwSJCjYpA6tXbCNiuHGquYsEkYQK HnKflnqWy QB5dcSUpAS52POwvrbqSuDjvARU2iwro8EBNfbdbrh8g==
Cache-Control: no-cache
Expires: -1

Chad-o-chef.co.za Domain Nameserver Information

HostIP AddressCountry
ns1.host-h.net 129.232.248.30
ns2.host-h.net 129.232.248.40
ns1.dns-h.com 129.232.248.30


Need to find out who hosts Chad-o-chef.co.za?


Domain Registration (WhoIs) information for Chad-o-chef.co.za

 simple CO.ZA whois server
The CO.ZA simple whois server
© Copyright ZACR 1995-2020
Use of this facility subject to theterms of site usage
Your query has generated the following reply:-

Search on chad-o-chef (.co.za)
Match: One

Domain: chad-o-chef.co.za

Accounting info....
Date |Type| Cost |Invoices are E-Mail to....|Paid Date |ICnt| TrkNo |Billing Info

Flashing RED indicates that payment has not been received - please
confirm with the ZACR accounting department, Login to show email
should this
not be according to your records. You have been sent 0 invoices/statements.

0a. lastupdate :
0b. emailsource : REDACTED
0c. emailposted :
0d. emailsubject :
0g. historycount :
0h. invoiceno :
0i. contracttype :
0j. rcsversion :
1a. domain : chad-o-chef.co.za
1b. action :
1c. Registrar : xneelo (Pty) Ltd
2a. registrant : REDACTED
2b. registrantpostaladdress: REDACTED
2c. registrantstreetaddress: REDACTED
2d. amount : REDACTED
2e. paymenttype : REDACTED
2f. billingaccount : REDACTED
2g. billingemail : REDACTED
2i. invoiceaddress : REDACTED
2j. registrantphone : REDACTED
2k. registrantfax : REDACTED
2l. registrantemail : REDACTED
2n. vat : REDACTED
3b. cname :
3c. cnamesub1 :
3d. cnamesub2 :
3e. creationdate : 1997/10/13 00:00:00
4a. admin : REDACTED
4b. admintitle : REDACTED
4c. admincompany : REDACTED
4d. adminpostaladdr : REDACTED
4e. adminphone : REDACTED
4f. adminfax : REDACTED
4g. adminemail : REDACTED
4h. adminnic : REDACTED
5a. tec : REDACTED
5b. tectitle : REDACTED
5c. teccompany : REDACTED
5d. tecpostaladdr : REDACTED
5e. tecphone : REDACTED
5f. tecfax : REDACTED
5g. tecemail : REDACTED
5h. tecnic : REDACTED
6a. primnsfqdn : ns1.host-h.net
6b. primnsip :
6c. primnsipv6 :
6e. secns1fqdn : ns2.host-h.net
6f. secns1ip :
6g. secns1ipv6 :
6i. secns2fqdn : ns1.dns-h.com
6j. secns2ip :
6k. secns2ipv6 :
6m. secns3fqdn :
6n. secns3ip :
6o. secns3ipv6 :
6q. secns4fqdn :
6r. secns4ip :
6s. secns4ipv6 :
8a. netblock1start :
8b. netblock1end :
8c. netblock2start :
8d. netblock2end :
8e. netblock3start :
8f. netblock3end :
9a. description1 :
9b. description2 :
9c. description3 :
9d. description4 :
9e. description5 :
9f. description6 :

Next Query - Domain name
.co.za
Please refer to the CO.ZA contact details should you have any problems

Websites with Similar Names

Chad-5.info
White News And Black News – Trustworthy Worldwide News
Chad-allen.com
chad-allen.com is coming soon
Chad-and-clark.com
403 Forbidden
Chad-appliance.com
Chad's Appliance Repair - #1 Rated Repair Company
Chad-burton.com
CHAD BURTON

Recently Updated Websites

Up426cisce.org (6 seconds ago.)Numbersandbots.com (7 seconds ago.)Youthonomics.com (7 seconds ago.)Papir.online (9 seconds ago.)Whitegownwedding.com (9 seconds ago.)Quadcitiesrealtors.com (11 seconds ago.)Opiniones.org.es (11 seconds ago.)Mshholistictherapies.com (13 seconds ago.)Cosme-mama.com (13 seconds ago.)Jianggeshuo.com (13 seconds ago.)6666ke.com (13 seconds ago.)Reach4me.org (15 seconds ago.)Flooringcheshireltd.org (17 seconds ago.)Wcintl.us (18 seconds ago.)Aoa2850.app (18 seconds ago.)Slimsolutionplus.com (20 seconds ago.)Babyboomersearchandrescue.com (20 seconds ago.)Fanhuiapp.mobi (22 seconds ago.)Aaaeion.com (22 seconds ago.)Hawthornshomes.com (23 seconds ago.)Indy.coffee (24 seconds ago.)Koperasipandawamandirigroup.wordpress.com (24 seconds ago.)Brandtdev.com (25 seconds ago.)Monicaeyoung.com (25 seconds ago.)Erpsolution.net (26 seconds ago.)Owahd.org (29 seconds ago.)Temptuprotattoos.us (30 seconds ago.)Betesporte.com (30 seconds ago.)Stansargeant.com (30 seconds ago.)Frozationnation.com (32 seconds ago.)

Recently Searched Keywords

taurus apr 20 - may 20 (2 seconds ago.)sex emulator (3 seconds ago.)address signs (5 seconds ago.)sheenobu (6 seconds ago.)1s blockb1dub (7 seconds ago.)atthe (8 seconds ago.)hcm and erp integrations (8 seconds ago.)best portable blenders 2021 (8 seconds ago.)understanding versus rote learning (10 seconds ago.)water utility (11 seconds ago.)thng trc cn (12 seconds ago.)characters faq (14 seconds ago.)вардане (15 seconds ago.)español (mexicano) (17 seconds ago.)经典12p (23 seconds ago.)nmdcj (23 seconds ago.)weather nyc 14 days (25 seconds ago.)magellan 800i (26 seconds ago.)8211 metro water (28 seconds ago.)bykehir olmal (30 seconds ago.)tegogolos in english (31 seconds ago.)sign now (33 seconds ago.)mahemir full movie (34 seconds ago.)tangential velocity formula (36 seconds ago.)storeidentifierinputtagnamestoreidentifier storeidentifierinputtagtypehidden (36 seconds ago.)2016 mdash (38 seconds ago.)isabelline (39 seconds ago.)other decorative (6434) (40 seconds ago.)phantom (43 seconds ago.)beyaz eya servisi (43 seconds ago.)