Chaitanya Travels - "Enjoy Holidays"

Chaitanya Travels has handled thousands of national and international tourists to India in last 12 years. A Govt. of India approved travel agent and tour operator. Best Car Rental, Bus booking, Train reservation, Flight booking Copany in Pune with lowest fare and good quality fleet, Rent car for out station, Car Hire, Airport Drop, Air Ticket, Tour Packages, Rent Car, Pune, Mumbai, Maharashtra, customized tour packages, tour packages for shirdi, shani shingnapur and ahmednagar, Travel Agents and Tour operators for Entire World


Domain summary

SafetyLow trust score
Year Founded
2013
Global Traffic Rank
Unknown
Estimated Worth
$240
Last updated
2015-12-22
Domain label
chaitanyatravels
Domain extension
info
Domain registered:
2013-01-31
Domain updated:
0000-00-00
Domain expires:
0000-00-00
Statvoo Rating
I
Estimated daily income
$1
Estimated monthly income
$30

Frequently Asked Questions (FAQ)

Q: When was Chaitanyatravels.info registered?
A: Chaitanyatravels.info was registered 9 years, 6 months, 2 weeks, 10 hours, 12 minutes, 10 seconds ago on Thursday, January 31, 2013.
Q: When was the WHOIS for Chaitanyatravels.info last updated?
A: The WHOIS entry was last updated 2022 years, 8 months, 2 weeks, 10 hours, 12 minutes, 10 seconds ago on Monday, November 30, -0001.
Q: What are Chaitanyatravels.info's nameservers?
A: DNS for Chaitanyatravels.info is provided by the following nameservers:
  • ns1.webpresenceworld.com
  • ns2.webpresenceworld.com
Q: Who is the registrar for the Chaitanyatravels.info domain?
A: The domain has been registered at .
Q: What is the traffic rank for Chaitanyatravels.info?
A: Chaitanyatravels.info has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Chaitanyatravels.info each day?
A: Chaitanyatravels.info receives approximately 62 visitors and 168 page impressions per day.
Q: What IP address does Chaitanyatravels.info resolve to?
A: Chaitanyatravels.info resolves to the IPv4 address 118.67.248.199.
Q: In what country are Chaitanyatravels.info servers located in?
A: Chaitanyatravels.info has servers located in the India.
Q: What webserver software does Chaitanyatravels.info use?
A: Chaitanyatravels.info is powered by Apache/2.4.3 (Unix) PHP/5.4.7 webserver.
Q: Who hosts Chaitanyatravels.info?
A: Chaitanyatravels.info is hosted by Net4India Ltd in India.
Q: How much is Chaitanyatravels.info worth?
A: Chaitanyatravels.info has an estimated worth of $240. An average daily income of approximately $1, which is roughly $30 per month.

Chaitanyatravels.info Free SEO Report

Website Inpage Analysis for Chaitanyatravels.info

H1 Headings

1 :
  1. 1

H2 Headings

1 :
  1. 3

H3 Headings

1 :
  1. 1

H4 Headings

1 :
  1. 0

H5 Headings

1 :
  1. 0

H6 Headings

1 :
  1. 0

Total IFRAMEs

0 :

Total Images

11 :

Links - Internal

1:

Links - Internal (nofollow)

1:

Links - Outbound

1:

Links - Outbound (nofollow)

1:

Who hosts Chaitanyatravels.info?

Chaitanyatravels.info Hosting Provider Information

Hosted IP Address:118.67.248.199
Hosted Hostname:corp12.net4india.com
Service Provider:Net4India Ltd
Hosted Country:IndiaIN
Location Latitude:20.0063
Location Longitude:77.006
Webserver Software:Apache/2.4.3 (Unix) PHP/5.4.7

Is "Net4India Ltd" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
20.7263%
GOOGLE
14.6821%
AS-26496-GO-DADDY-COM-LLC
3.5109%
NAMECHEAP-NET
3.2517%
AMAZON-AES
2.3474%
UNIFIEDLAYER-AS-1
2.0808%
GoDaddy.com, LLC
2.0465%
Fara Negar Pardaz Khuzestan
1.7230%
AMAZON-02
1.6509%
CONFLUENCE-NETWORK-INC
1.5204%
Net4India Ltd
0.0150%

Chaitanyatravels.info Domain Nameserver Information

HostIP AddressCountry
ns1.webpresenceworld.com 113.30.140.95
ns2.webpresenceworld.com 202.71.128.222

Common Spelling Mistakes for Chaitanyatravels.info

xhaitanyatravels.infoshaitanyatravels.infodhaitanyatravels.infofhaitanyatravels.info
vhaitanyatravels.infocbaitanyatravels.infocgaitanyatravels.infoctaitanyatravels.info
cyaitanyatravels.infocuaitanyatravels.infocjaitanyatravels.infocmaitanyatravels.info
cnaitanyatravels.infochqitanyatravels.infochwitanyatravels.infochzitanyatravels.info
chxitanyatravels.infochautanyatravels.infochajtanyatravels.infochaktanyatravels.info
chaltanyatravels.infochaotanyatravels.infochairanyatravels.infochaifanyatravels.info
chaiganyatravels.infochaihanyatravels.infochaiyanyatravels.infochaitqnyatravels.info
chaitwnyatravels.infochaitznyatravels.infochaitxnyatravels.infochaitabyatravels.info
chaitagyatravels.infochaitahyatravels.infochaitajyatravels.infochaitamyatravels.info
chaitantatravels.infochaitangatravels.infochaitanhatravels.infochaitanjatravels.info
chaitanuatravels.infochaitanyqtravels.infochaitanywtravels.infochaitanyztravels.info
chaitanyxtravels.infochaitanyarravels.infochaitanyafravels.infochaitanyagravels.info
chaitanyahravels.infochaitanyayravels.infochaitanyateavels.infochaitanyatdavels.info
chaitanyatfavels.infochaitanyatgavels.infochaitanyattavels.infochaitanyatrqvels.info
chaitanyatrwvels.infochaitanyatrzvels.infochaitanyatrxvels.infochaitanyatraels.info
chaitanyatracels.infochaitanyatradels.infochaitanyatrafels.infochaitanyatragels.info
chaitanyatrabels.infochaitanyatravwls.infochaitanyatravsls.infochaitanyatravdls.info
chaitanyatravfls.infochaitanyatravrls.infochaitanyatraveps.infochaitanyatraveos.info
chaitanyatraveis.infochaitanyatraveks.infochaitanyatravems.infochaitanyatravelq.info
chaitanyatravelw.infochaitanyatravele.infochaitanyatravelz.infochaitanyatravelx.info
chaitanyatravelc.infochaitanyatravels.unfochaitanyatravels.jnfochaitanyatravels.knfo
chaitanyatravels.lnfochaitanyatravels.onfochaitanyatravels.ibfochaitanyatravels.igfo
chaitanyatravels.ihfochaitanyatravels.ijfochaitanyatravels.imfochaitanyatravels.inco
chaitanyatravels.indochaitanyatravels.ineochaitanyatravels.inrochaitanyatravels.into
chaitanyatravels.ingochaitanyatravels.inbochaitanyatravels.invochaitanyatravels.infi
chaitanyatravels.infkchaitanyatravels.inflchaitanyatravels.infp 

Websites with Similar Names to Chaitanyatravels.info

Chait-np.online
Build a Free Website - Sitebeat
Chait.com
Welcome to Chait
Chait.net
My Blog – My WordPress Blog
Chaita.wang
click.com.cn
Chaitable.com
Financeflick.com
Chaitag.com
Chaitag.com
Chaitaifactorydirect.com
CHAI TAI FACTORY direct