Chatten met Vreemden - Chat Nu

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: Unknown
Estimated Worth: $9

Spannende chats met mensen uit jouw omgeving volledig anoniem. Chatten met vreemden is nog nooit zo leuk geweest!



Domain summary

Last updated
2021-09-16
Domain label
chatnu
Domain extension
nl
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Chatnu.nl registered?
A: Chatnu.nl was registered 1 month, 1 week, 17 hours, 21 minutes, 52 seconds ago on Thursday, September 16, 2021.
Q: When was the WHOIS for Chatnu.nl last updated?
A: The WHOIS entry was last updated 1 month, 1 week, 17 hours, 21 minutes, 52 seconds ago on Thursday, September 16, 2021.
Q: What are Chatnu.nl's nameservers?
A: DNS for Chatnu.nl is provided by the following nameservers:
  • eric.ns.cloudflare.com
  • eva.ns.cloudflare.com
Q: Who is the registrar for the Chatnu.nl domain?
A: The domain has been registered at Stichting Internet Domeinregistratie NL.
Q: What is the traffic rank for Chatnu.nl?
A: Chatnu.nl has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Chatnu.nl each day?
A: Chatnu.nl receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Chatnu.nl resolve to?
A: Chatnu.nl resolves to the IPv4 address 104.26.1.33.
Q: In what country are Chatnu.nl servers located in?
A: Chatnu.nl has servers located in the United States.
Q: What webserver software does Chatnu.nl use?
A: Chatnu.nl is powered by CloudFlare webserver.
Q: Who hosts Chatnu.nl?
A: Chatnu.nl is hosted by TOT Public Company Limited in United States.
Q: How much is Chatnu.nl worth?
A: Chatnu.nl has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Chatnu.nl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Chatnu.nl Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Chatnu.nl

H1 Headings

1 :
  1. Chatten met vreemden

H2 Headings

7 :
  1. Wat is jouw geslacht?
  2. Waar woon je?
  3. Verzin een schuilnaam
  4. Verzin een wachtwoord
  5. Wat is jouw geboortedatum?
  6. Wat is jouw E-mailadres?
  7. Duizenden actieve leden

H3 Headings

1 :
  1. Wil jij chatten met vreemden?

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-127840643-6

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Chatnu.nl

watakkoordtoegangsverbodvoorop onze websitegebruikonze websiteujaarchatnuwijwebsitemaken vanentertainment profielenonlinejouwfysieke afsprakencontactdezezijnakkoord metchatbeneenchatten metmakenikafsprakenwat is jouwduizendenchattendatmet vreemdenopmetgratisbedoeld voorbedoeldvorigelaquooudervan deze websitelaquo vorigeop onzegebruik vankuntalgemene voorwaardendeclinetermsprivacyverder laquodeze websitetevan dezeallejevreemdenaanchatten met vreemdenalgemenevoorwaardenhettotvanverderop dezenietomverder laquo vorigedanprofielengadoormogelijkentertainmentnaarfysiekeonze

Who hosts Chatnu.nl?

Chatnu.nl Hosting Provider Information

Hosted IP Address:104.26.1.33
Hosted Hostname:104.26.1.33
Service Provider:TOT Public Company Limited
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "TOT Public Company Limited" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
15.4249%
Unknown
11.7059%
AS-26496-GO-DADDY-COM-LLC
4.1307%
NAMECHEAP-NET
3.3122%
AMAZON-AES
2.5118%
GoDaddy.com, LLC
2.1535%
UNIFIEDLAYER-AS-1
2.1315%
Fara Negar Pardaz Khuzestan
1.7839%
CONFLUENCE-NETWORK-INC
1.5636%
1&1 Internet AG
1.4878%
TOT Public Company Limited
0.6855%

HTTP Header Analysis for Chatnu.nl

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 16 Sep 2021 13:54:13 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: no-cache, must-revalidate
Pragma: no-cache
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v3?s=KgfBZNqgKPKFkcyFCOUZ6flphcpNZ8QKUbNTCLLtT8o6mK3jQ8+bpqh+jBLr0uW/byV4biIZzOK7DdRsKl4iZR84jvCyVPRAkUHSfYNz2EXrlPEOw5vS3/VDmtI="}],"group":"cf-nel","max_age":604800}
NEL: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 68fa95e22ad921a9-LHR
Content-Encoding: gzip

Chatnu.nl Domain Nameserver Information

HostIP AddressCountry
eric.ns.cloudflare.com 173.245.59.112
eva.ns.cloudflare.com 173.245.58.114


Need to find out who hosts Chatnu.nl?


Domain Registration (WhoIs) information for Chatnu.nl

 Domain name: chatnu.nl
Status: active

Registrar:
EuroDNS S.A.
Rue Léon Laval 21
L-3372 Leudelange
Luxembourg

Abuse Contact:

Creation Date: 2001-12-18

Updated Date: 2019-10-02

DNSSEC: no

Domain nameservers:
eric.ns.cloudflare.com
eva.ns.cloudflare.com

Record maintained by: NL Domain Registry

As the registrant's address is not in the Netherlands, the registrant is
obliged by the General Terms and Conditions for .nl Registrants to use
SIDN's registered office address as a domicile address. More information
on the use of a domicile address may be found at
https://www.sidn.nl/downloads/procedures/Domicile_address.pdf

Copyright notice
No part of this publication may be reproduced, published, stored in a
retrieval system, or transmitted, in any form or by any means,
electronic, mechanical, recording, or otherwise, without prior
permission of the Foundation for Internet Domain Registration in the
Netherlands (SIDN).
These restrictions apply equally to registrars, except in that
reproductions and publications are permitted insofar as they are
reasonable, necessary and solely in the context of the registration
activities referred to in the General Terms and Conditions for .nl
Registrars.
Any use of this material for advertising, targeting commercial offers or
similar activities is explicitly forbidden and liable to result in legal
action. Anyone who is aware or suspects that such activities are taking
place is asked to inform the Foundation for Internet Domain Registration
in the Netherlands.
(c) The Foundation for Internet Domain Registration in the Netherlands
(SIDN) Dutch Copyright Act, protection of authors' rights (Section 10,
subsection 1, clause 1).

Websites with Similar Names

Chatn.org
CHA TN - A Roadmap to Better Care and a Healthier You.
Chatna.chat
شات عربي | غرف دردشة عربية تعارف مجاني بدون تسجيل
Chatna.org
?? ??? ????? ?? ?? , ?? ??? ????????
Chatna.us
شات عربي | شاتنا | دردشة عربية مجانية بدون تسجيل
Chatna2.ir
چت نا|چت روم ایناز| ایناز گپ

Recently Updated Websites

Mjcpichon.org (5 seconds ago.)Longplay.dev (6 seconds ago.)Ppnz.com.cn (7 seconds ago.)Healthhackerbook.com (12 seconds ago.)Naturaku.net (13 seconds ago.)Travel-destination-pictures.com (13 seconds ago.)Iamyouthgroup.org (14 seconds ago.)Openhousebrand.com (16 seconds ago.)Stephanie-price.com (16 seconds ago.)Allymorgann.org (17 seconds ago.)Basicmormonbeliefs.com (17 seconds ago.)Liverpoolrecruit.com (19 seconds ago.)Tetradimensions.com (20 seconds ago.)Electronicmail.space (21 seconds ago.)Mariabadias.com (27 seconds ago.)Vedaglobalpartners.com (28 seconds ago.)Superhuayd.com (29 seconds ago.)Platcircles.com (33 seconds ago.)Acheimeulook.com (33 seconds ago.)Xerpa.pro (35 seconds ago.)Dogincommon.com (37 seconds ago.)Bosswebinar.com (37 seconds ago.)Mpapdc.com (38 seconds ago.)Kinnamons.com (39 seconds ago.)Smartcrowd.cz (41 seconds ago.)Japanese-bukkake.com (41 seconds ago.)Videopup.com (43 seconds ago.)License2hire.net (44 seconds ago.)Lancopure.com (44 seconds ago.)Edinburghsnursery.com (45 seconds ago.)

Recently Searched Keywords

botprize (2 seconds ago.)virtabet (3 seconds ago.)femme (5 seconds ago.)vagas de emprego (7 seconds ago.)spiral notebook ruled (9 seconds ago.)wk darts tickets (14 seconds ago.)数学基础知识:小学数学面积问题 (16 seconds ago.)scipy.optimize.minimize two variables bounds (17 seconds ago.)2 pièces ensembles streetwear (22 seconds ago.)derece yayınları 10.sınıf matematik fasik (26 seconds ago.)femme (28 seconds ago.)help housing (28 seconds ago.)x plane 11 free download 2019 (31 seconds ago.)femme (33 seconds ago.)ivydiv (34 seconds ago.)4. sınıf sınav soruları (36 seconds ago.)in morocco (37 seconds ago.)luxury wedding cars (42 seconds ago.)what we digitize (44 seconds ago.)stoic-bear.gif (50 seconds ago.)thereward89 (59 seconds ago.)frais de licence (1 minute 2 seconds ago.)ularpoptoptions liarpevenrowbackgroundedededimportantcolor333333importantarptemplatemainarpfrontmaincontainer arptemplate123 (1 minute 7 seconds ago.)da una (1 minute 8 seconds ago.)japanese mom (1 minute 12 seconds ago.)data null strtemplate (1 minute 18 seconds ago.)黄色网站 (1 minute 23 seconds ago.)cadasil (1 minute 25 seconds ago.)g l (1 minute 36 seconds ago.)dekbedovertrek (1 minute 39 seconds ago.)