Cheap Gay Porn Club - The Same Porn For Less Money

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

You don't have to join this club to save lots of money on Gay porn. Just read our reviews, click our links and get instant savings of up to 85% on hot sites like Men.com and Next Door Buddies.



Domain summary

Last updated
2020-10-15
Domain label
cheapgayporn
Domain extension
club
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is cheapgayporn.club ranked relative to other sites:

Percentage of visits to cheapgayporn.club from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Cheapgayporn.club registered?
A: Cheapgayporn.club was registered 6 months, 3 weeks, 6 days, 7 hours, 21 minutes, 23 seconds ago on Thursday, October 15, 2020.
Q: When was the WHOIS for Cheapgayporn.club last updated?
A: The WHOIS entry was last updated 6 months, 3 weeks, 6 days, 7 hours, 21 minutes, 23 seconds ago on Thursday, October 15, 2020.
Q: What are Cheapgayporn.club's nameservers?
A: DNS for Cheapgayporn.club is provided by the following nameservers:
  • ken.ns.cloudflare.com
  • coco.ns.cloudflare.com
Q: Who is the registrar for the Cheapgayporn.club domain?
A: The domain has been registered at .
Q: What is the traffic rank for Cheapgayporn.club?
A: Cheapgayporn.club has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Cheapgayporn.club each day?
A: Cheapgayporn.club receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Cheapgayporn.club resolve to?
A: Cheapgayporn.club resolves to the IPv4 address 104.27.158.2.
Q: In what country are Cheapgayporn.club servers located in?
A: Cheapgayporn.club has servers located in the United States.
Q: What webserver software does Cheapgayporn.club use?
A: Cheapgayporn.club is powered by CloudFlare webserver.
Q: Who hosts Cheapgayporn.club?
A: Cheapgayporn.club is hosted by TOT Public Company Limited in United States.
Q: How much is Cheapgayporn.club worth?
A: Cheapgayporn.club has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Cheapgayporn.club Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Cheapgayporn.club Free SEO Report

Website Inpage Analysis for Cheapgayporn.club

H1 Headings

0 :

H2 Headings

13 :
  1. $5.00 – Gay Room Discount (Save 84%) – Cheap Gay Porn Club
  2. $5.00 – Boys Destroyed Discount (Save 84%) – Cheap Gay Porn Club
  3. $16.43 – Helix Studios Discount (Save 53%) – Cheap Gay Porn Club
  4. $7.50 – Raw Euro Discount (Save 70%) – Cheap Gay Porn Club
  5. $19.95 – Euro Creme Discount (Save 21%) – Cheap Gay Porn Club
  6. $12.50 – Jason Sparks Live Discount (Save 50%) – Cheap Gay Porn Club
  7. $10.00 – UK Hot Jocks Discount (Save 75%) – Cheap Gay Porn Club
  8. $10.00 – Young Bastards Discount (Save 75%) – Cheap Gay Porn Club
  9. $16.66 – COLT Studio Group Discount (Save 45%) – Cheap Gay Porn Club
  10. $16.50 – Bang Bang Boys Discount (Save 34%) – Cheap Gay Porn Club
  11. $14.95 – Jalif Studio Discount (Save 41%) – Cheap Gay Porn Club
  12. $9.95 – Club Amateur USA Discount (Save 81%) – Cheap Gay Porn Club
  13. $9.95 – BadPuppy Discount (Save 81%) – Cheap Gay Porn Club

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

16 :
  1. Latest Posts
  2. $7.50 – Raw Euro Discount (Save 70%) – Cheap Gay Porn Club
  3. $19.95 – Euro Creme Discount (Save 21%) – Cheap Gay Porn Club
  4. $12.50 – Jason Sparks Live Discount (Save 50%) – Cheap Gay Porn Club
  5. $10.00 – UK Hot Jocks Discount (Save 75%) – Cheap Gay Porn Club
  6. $10.00 – Young Bastards Discount (Save 75%) – Cheap Gay Porn Club
  7. $7.50 – Raw Euro Discount (Save 70%) – Cheap Gay Porn Club
  8. $19.95 – Euro Creme Discount (Save 21%) – Cheap Gay Porn Club
  9. $12.50 – Jason Sparks Live Discount (Save 50%) – Cheap Gay Porn Club
  10. $10.00 – UK Hot Jocks Discount (Save 75%) – Cheap Gay Porn Club
  11. $10.00 – Young Bastards Discount (Save 75%) – Cheap Gay Porn Club
  12. $16.66 – COLT Studio Group Discount (Save 45%) – Cheap Gay Porn Club
  13. $16.50 – Bang Bang Boys Discount (Save 34%) – Cheap Gay Porn Club
  14. $14.95 – Jalif Studio Discount (Save 41%) – Cheap Gay Porn Club
  15. $9.95 – Club Amateur USA Discount (Save 81%) – Cheap Gay Porn Club
  16. $9.95 – BadPuppy Discount (Save 81%) – Cheap Gay Porn Club

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

32 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

85:

Links - Outbound

1:

Links - Outbound (nofollow)

1:

Keyword Cloud for Cheapgayporn.club

gay porncreme discountfunction wppobserveimgs9discount save 8445gayminwidth1250 8211 jason8211 euroscreendiscount save 21guysporn club athleticporn club0your6room discountdiscount save 50sitegroupbang boys50 8211 cheapif wppwidgetimageslengthsparksgay porn discountsgay room discount8211 rawwppimageslength8211 young bastardsclub decembercolt studiouk hot jockscontentjason17letraw8211 euro creme11colt studio group138211 jason sparksvarwppwidgetslengthsave 50 821181 82111995 2495 get500 8211live discount save84 82112123studio groupclub amateurdecember 13jalif studio70 8211 cheap8211 uk hotdiscount savebastards discount7cremescreen and minwidth3750 8211 rawdiscountcreme discount savewppobserveimgsmarch18hascoltsave 21 821112euro discountyoung bastardscheap gay pornyoungwppwidgetimageslengthdecember 13 2017euro creme discountbangclub amateur usaamateur usa1000 8211 ukjason sparks livesave 70 8211bang bangjockscheap gaydiscount save 81gay room1575 821150 82111000 8211 youngdiscountslive discount8211 raw euroathletic 100075 8211 cheapamateurbastardsyoulllivedecember202sceneswppwidgetimagessave 21161995 8211club gay pornporn club decembersexclub athletic 100010750 8211hot jocks discountbang bang boys1250 8211porn club gayclub athleticeuro84 8211 cheap1995 8211 euro22haveporn discountsdiscount save 7570 8211ukget2495 get13 2017julyuk hotsave 50save 75 8211sparks live discountsave 81roomeuro cremeif8211 ukbastards discount saveyoung bastards discountwppwidgetsjocks discount8211 cheapraw euro21 8211 cheap81 8211 cheapcheapsave 84 821114hardhotyou8211 youngathletic824club gay8211 cheap gay21 821119usaathletic 1000 8211discount save 70gay porn club1000 8211raw euro discountj1995 2495october1save 70studiofunctionclubcollectionsavejocks discount saveif wppimageslengthpornboys8211 jasonsave 75euro discount saveget this dealsparks livejason sparksjalifsitesmosthot jocksk995 8211club december 13save 81 8211save 84deal

Longtail Keyword Density for Cheapgayporn.club

KeywordsOccurences
cheap gay porn33
gay porn club33
8211 cheap gay32
get this deal11
gay porn discounts8
club gay porn7
porn club gay7
porn club athletic7
75 8211 cheap6
save 75 82116
discount save 756
81 8211 cheap4
club athletic 10004
jason sparks live4
athletic 1000 82114
save 81 82114
discount save 814
porn club december4
uk hot jocks4
sparks live discount4
euro creme discount3
colt studio group3
raw euro discount3
club december 133
december 13 20173
1000 8211 young3
8211 young bastards3
young bastards discount3
bastards discount save3
bang bang boys3
discount save 703
club amateur usa3
8211 raw euro3
750 8211 raw3
84 8211 cheap3
save 84 82113
discount save 843
gay room discount3
euro discount save3
save 70 82113
creme discount save3
1995 8211 euro3
discount save 213
save 21 82113
21 8211 cheap3
1995 2495 get3
1250 8211 jason3
8211 jason sparks3
8211 euro creme3
live discount save3
jocks discount save3
discount save 503
save 50 82113
50 8211 cheap3
1000 8211 uk3
8211 uk hot3
70 8211 cheap3
hot jocks discount3
screen and min-width3
gay porn47
cheap gay33
porn club33
discount save32
8211 cheap32
porn discounts8
club gay7
club athletic7
75 82116
save 756
1000 82116
995 82115
2495 get5
81 82114
athletic 10004
save 814
jason sparks4
club december4
hot jocks4
uk hot4
sparks live4
live discount4
if wppwidgetimageslength4
84 82113
young bastards3
bastards discount3
colt studio3
studio group3
bang bang3
bang boys3
jalif studio3
club amateur3
13 20173
amateur usa3
save 843
room discount3
gay room3
500 82113
function wppobserveimgs3
if wppimageslength3
8211 young3
creme discount3
save 213
save 503
21 82113
1995 24953
1250 82113
8211 jason3
euro creme3
8211 euro3
1995 82113
50 82113
750 82113
70 82113
8211 uk3
save 703
euro discount3
jocks discount3
raw euro3
8211 raw3
december 133
064
gay53
porn49
club36
discount35
cheap33
save32
115
if15
get13
deal12
210
var10
38
discounts8
you8
47
boys7
athletic7
let7
hot6
56
december6
wppwidgetslength6
studio6
66
bang6
euro6
76
function6
wppwidgetimageslength5
85
jason5
live5
95
uk4
jocks4
collection4
october4
104
young4
scenes4
sparks4
wppimageslength4
your4
wppwidgetimages4
114
123
amateur3
133
screen3
usa3
creme3
min-width3
sites3
jalif3
most3
wppwidgets3
143
room3
wppobserveimgs3
153
j3
raw3
163
173
hard3
183
193
have3
203
youll3
213
march3
site3
guys3
223
233
content3
sex3
243
bastards3
has3
july3
colt3
group3
k3

Who hosts Cheapgayporn.club?

Cheapgayporn.club Hosting Provider Information

Hosted IP Address:104.27.158.2
Hosted Hostname:104.27.158.2
Service Provider:TOT Public Company Limited
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "TOT Public Company Limited" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.7948%
GoDaddy.com, LLC
8.0700%
Namecheap, Inc.
4.0119%
Confluence Networks Inc
2.6770%
Fara Negar Pardaz Khuzestan
2.1305%
Google Inc.
2.1184%
Merit Network Inc.
1.8272%
1&1 Internet AG
1.8076%
Cogent Communications
1.7178%
CloudFlare, Inc.
1.6296%
TOT Public Company Limited
0.9696%

HTTP Header Analysis for Cheapgayporn.club

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Thu, 15 Oct 2020 12:02:48 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: max-age=3600
Expires: Thu, 15 Oct 2020 13:02:48 GMT
Location: https://cheapgayporn.club/
cf-request-id: 05cdbd409400000782b4837000000001
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?lkg-colo=21&lkg-time=1602763369"}],"group":"cf-nel","max_age":604800}
NEL: {"report_to":"cf-nel","max_age":604800}
Vary: Accept-Encoding
Server: cloudflare
CF-RAY: 5e2964adbcc90782-LHR
alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400

Cheapgayporn.club Domain Nameserver Information

HostIP AddressCountry
ken.ns.cloudflare.com 108.162.193.127
coco.ns.cloudflare.com 108.162.192.104


Need to find out who hosts Cheapgayporn.club?


Domain Registration (WhoIs) information for Cheapgayporn.club

 Domain Name: cheapgayporn.club
Registry Domain ID: D3259231-CLUB
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: publicdomainregistry.com
Updated Date: 2020-03-07T22:22:33Z
Creation Date: 2016-03-22T04:51:27Z
Registry Expiry Date: 2021-03-21T23:59:59Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2013775952
Domain Status: ok https://icann.org/epp#ok
Registry Registrant ID:
Registrant Name:
Registrant Organization: J2media
Registrant Street:
Registrant Street:
Registrant Street:
Registrant City:
Registrant State/Province: California
Registrant Postal Code:
Registrant Country: US
Registrant Phone:
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Admin ID:
Admin Name:
Admin Organization:
Admin Street:
Admin Street:
Admin Street:
Admin City:
Admin State/Province:
Admin Postal Code:
Admin Country:
Admin Phone:
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registry Tech ID:
Tech Name:
Tech Organization:
Tech Street:
Tech Street:
Tech Street:
Tech City:
Tech State/Province:
Tech Postal Code:
Tech Country:
Tech Phone:
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: ken.ns.cloudflare.com
Name Server: coco.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-10-15T12:02:49Z

Websites with Similar Names

Cheap--auto--insurance.com
Insurance Marketing Multiplier | Insurance Marketing for Carriers and Large Agencies
Cheap--boats.com
Cheap Boats: 2011 Top 3 options to finding dirt, cheap boats for sale.
Cheap--dedicated--servers.com
Cheap--Dedicated--Servers.com
Cheap--domain.com
Cheap--Domain.com
Cheap--domains.com
Cheap--Domains.com
Cheap--flights.com
cheap--flights.com
Cheap--hats.com
dafa官网客户端下载-大发bet手机网页版登录-亚洲最大唯一授权网站
Cheap--phone-sex.com
Cheap Phone Sex - 888-505-5592 - Just 29 Cents a Minute
Cheap--purses.com
Cheap Purses are available in a wide purses selection.

Recently Updated Websites

Tampanpoker.net (4 seconds ago.)Yyvip4589.com (4 seconds ago.)Tiyuvip1650.com (6 seconds ago.)Jsrepublic.com (7 seconds ago.)Dholerasla.com (7 seconds ago.)Dynamiccathloic.com (7 seconds ago.)Ynstone.cn (7 seconds ago.)Vanity-amenties.com (8 seconds ago.)Playnewyorkpoker.com (8 seconds ago.)Thepaullfamily.com (9 seconds ago.)Turlock.us (9 seconds ago.)Ykjintuo.com (9 seconds ago.)Acrimoniousprior.life (10 seconds ago.)Coachjonestrackexpert.com (11 seconds ago.)Diamba.info (11 seconds ago.)Icanquit.com.au (11 seconds ago.)Jamo.tv (11 seconds ago.)Businessforvenezuela.com (12 seconds ago.)Harmonyhealingarts.net (12 seconds ago.)Zoosextv.com (12 seconds ago.)Parandeya.com (13 seconds ago.)Madrid-babysitter.com (13 seconds ago.)Woodwoodtoys.com (14 seconds ago.)Geocareers.ltd (14 seconds ago.)Primalagemedicine.com (14 seconds ago.)Moodswings.gr (14 seconds ago.)Resourceword.com (15 seconds ago.)Inspiremylook.com (15 seconds ago.)Chagal.net (15 seconds ago.)Hastestreet.com (16 seconds ago.)

Recently Searched Keywords

srednje škole – upis (1 second ago.)nwea map test scores chart 2020 (3 seconds ago.)perdeler rustik perde (3 seconds ago.)domainsherpa review – jan 16: carve.com, monkeywrench.com, finecars.com… (3 seconds ago.)src localmontserrat bold (3 seconds ago.)border-stylenone (5 seconds ago.)magnificent musings - complete trend blend - december 2020 regular price $2000 $20.00 (6 seconds ago.)hudek (8 seconds ago.)лестничный бк (8 seconds ago.)style-kai8e384labelwrapper (12 seconds ago.)ohjah (13 seconds ago.)typography design illustration (17 seconds ago.)elder: создание 3d персонажа и его кинематографическая презентация (19 seconds ago.)names for their (20 seconds ago.)end stylable (20 seconds ago.)freshly printed (21 seconds ago.)cartier architecte toulouse (23 seconds ago.)call for entries yearbook of type 2020 (24 seconds ago.)show all publications (26 seconds ago.)get into coin collecting (26 seconds ago.)doposci uomo (27 seconds ago.)shape grammars (27 seconds ago.)  pielęgnacja i konserwacja (31 seconds ago.)events (31 seconds ago.)dm5se (32 seconds ago.)like (32 seconds ago.)slanted publishers (33 seconds ago.)subscriptions (34 seconds ago.)perempuan islami (36 seconds ago.)one (36 seconds ago.)