Chesco.org  |  Chester County, PA - Official Website
Low trust score  | 
Home




Chesco.org Website Information

Website Ranks & Scores for Chesco.org

Statvoo Rank Statvoo Rank:G
Alexa Rank Alexa Rank:486,355
Majestic Rank Majestic Rank:107,149
Domain Authority Domain Authority:61%
DMOZ DMOZ Listing:No

Whois information for chesco.org

Full Whois Lookup for Chesco.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Chesco.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: CHESCO.ORG
Registry Domain ID: D1394898-LROR
Registrar WHOIS Server:
Registrar URL: http://www.networksolutions.com
Updated Date: 2017-03-06T21:19:52Z
Creation Date: 1998-03-07T05:00:00Z
Registry Expiry Date: 2027-03-06T05:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C2861580-LROR
Registrant Name: County of Chester
Registrant Organization: County of Chester
Registrant Street: 313 W Market ST
Registrant Street: PO BOX 2748
Registrant City: West Chester
Registrant State/Province: PA
Registrant Postal Code: 19382-2804
Registrant Country: US
Registrant Phone: +1.6103446000
Registrant Phone Ext:
Registrant Fax: +1.9999999999
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C106643065-LROR
Admin Name: James Ray
Admin Organization: County of Chester
Admin Street: 313 W Market ST
Admin Street: Suite 5302
Admin City: West Chester
Admin State/Province: PA
Admin Postal Code: 19380
Admin Country: US
Admin Phone: +1.6103446475
Admin Phone Ext:
Admin Fax: +1.6103445490
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C2861580-LROR
Tech Name: County of Chester
Tech Organization: County of Chester
Tech Street: 313 W Market ST
Tech Street: PO BOX 2748
Tech City: West Chester
Tech State/Province: PA
Tech Postal Code: 19382-2804
Tech Country: US
Tech Phone: +1.6103446000
Tech Phone Ext:
Tech Fax: +1.9999999999
Tech Fax Ext:
Tech Email: Login to show email
Server: NS3.P18.DYNECT.NET
Name Server: NS1.P18.DYNECT.NET
Name Server: NS2.P18.DYNECT.NET
Name Server: NS4.P18.DYNECT.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-09-03T08:08:58Z

Who hosts Chesco.org?

Chesco.org is hosted by Netsolus.com Inc. in Kansas, Manhattan, United States, 66502.
Chesco.org has an IP Address of 208.90.191.140 and a hostname of 191-140.civicplus.com and runs Microsoft-IIS/8.5 web server.



Chesco.org Web Server Information

Hosted IP Address:208.90.191.140
Hosted Hostname:191-140.civicplus.com
Service Provider:Netsolus.com Inc.
Hosted Country:United StatesUS
Location Latitude:39.1957
Location Longitude:-96.5976
Webserver Software:Microsoft-IIS/8.5

HTTP Header Analysis for Chesco.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
ETag: " "
Vary: Accept-Encoding
Server: Microsoft-IIS/8.5
p3p: CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT"
Date: Tue, 11 Aug 2015 11:31:52 GMT
Content-Length: 22791


Need to find out who hosts Chesco.org?

Chesco.org Free SEO Report

Website Inpage Analysis for Chesco.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Chesco.org

floodarea businessespaddingtop 10pxapplicationschester county departmentnorepeat backgroundpositionannouncedbackgroundimagerecognizescounty hasregularsunshine meetingpublic10pxwest chestercolorgrowthannouncesprogramleft fontstyletheirchestercounty departmentparticipateheroin addictiondocumentreadyfunctionpublic healthtextdecoration nonedigital countiescounty planning commissiondeputy10px paddingleftbeenreceiveoperationread on commissionerstextdecorationassociationcontactheldreturn falsetrailsfontstylehistoric preservationtextalignmontserrat textalignbusinessreceivedleft centerifbackgroundposition left centertextalign left fontstyleplatforminformationtakecommissionercozzonenorepeat backgroundposition leftquicklinksaspxchester county readweeknoticeseminarfontstyle regularawareness monthcolor 4a4a4a widgetsearchpublic safety12em fontfamilyunitedaddictionwerecommunitymenutype4a4a4ahascolor fff fontsizeuseducationfirstread on countyraiseboard of commissionerspaddingbottomfff fontsizesiteemploymentcounty sheriffsstafffarmpaddingleft 47px backgroundimagechairunitpagroupsmenuwidgetitemgraduatesguardnewday countywest05kcounty readpassportuniversityyearofficialspennsylvaniasonia huntzingertrainingcounty food bankcounty foodwidgetsearch12emfontsizeopenvoter serviceseshiftkeyspecialrecentlyfontfamily47pxeconomicbankhomeinitiativeelsetext textdecoration nonewecountiesvoternone backgroundrepeat norepeattakesfontsize 12em fontfamilynovemberread on healthdirector of chesterpaddingtopnation9chester countycommissioners presentfff fontsize 12emeconomic developmentoffcountyawarenessadditionalcounty planningpaddingleftoverdosepaddingbottom 10pxfontsize 12emfugitiveregular textdecoration nonesafetydayleft fontstyle regularcounty of chesteradditional info commissionersbackgroundrepeatpresentedeveningkennettbringsinfo chester countymonthcanfundsitssaturdaycommunitiesseeks3info81members10px paddingbottomattorneystatestopdirectororphansleft toptext color fffplanningflood insurancereceivesopioidmontserratmaychester county commissionershaveamericanread on chesternorepeatallresourcesadditional info chestersupportelectedwalkbackgroundposition left topofficefoundationchester county foodcodefffmeetinghostsblue resourcescounty commissioners presentnumber0 elseannualphoto contestphoenixvillecenter readbackgroundrepeat norepeat backgroundpositiondistrict attorneyupfancybutton250fancybuttonhoverplanchildrenactivities2commissionersemergency servicescounty sheriffs officetwolittlesoniachester countys departmentbusinessescounty commissioners announcechescocookiesinsuranceprogramscountys departmenthas beentextemailcrisisonecoatesvillecomprehensivefemaparkread on sheriffslauncheskichlinecolor 5kmarchpublic meetingorphans courtfarrellbluetext textdecoration5foodleftfontstyle regular textdecorationcontesttext colorsunshinesheriffs officefreelibrarymentalheroinsheriffhuntzingeryourif ewhichmaincounty commissionerscenterewhich10px paddingleft 47pxguardian program4a4a4a widgetsearchboardnationalchester county hostsbackgroundrepeat norepeatexcellenceindexgovernment10chester countyssecondspanpaddingleft 47pxfontfamily montserrat textalignareamontserrat textalign leftawardfalseysnsearchonlydept26aa8f4262774a4e99914dcfe5b5346aischeckedpagedevelopmentchester county planningservicescommissioners announceplace6mapslideshowcostssheriffsfontfamily montserratif ysnsearchonlydept26aa8f4262774a4e99914dcfe5b5346aischeckede ifagriculturalcolor fffofficersavailablek97countyspartdepartmentorganizationalhealth departmentcouncilteambunnycode blueplatform to employmentsignsurveytechnologybackgroundposition leftjusticepropertyvarintellectual15pxplanning commissionfraudulentguardiantextstyle1photononetextalign leftsepawardscounty to participatebackgroundpositionpaddingtop 10px paddingbottomcheckfood bankopioid and herointogetherwhichinterestederatingsduringeventdowidgetsearchthisvallocalwellness4residentsregular textdecorationhealthtextdecoration none backgroundrepeatcounty hostscounty residentsannouncereturnwidgetbodyhelpcolor 4a4a4ainfo commissionersadditional infodevelopment councildigitalpoliceemergencynone backgroundrepeathistoricfunctionpresentchester county sheriffsprescriptioncounty sheriffgreaterdrugnumber0displayfamiliesmarksmental healthowners10px paddingbottom 10pxchester county sheriffcounty governmentenablegoogletranslatedepartment of emergencyhealthiesttruecommissioninfo chesterfridaypreservationcode blue resourcesguidecourt12em fontfamily montserratnamed47px backgroundimagepaddingbottom 10px paddingleftdistrictsystemread

Longtail Keyword Density for Chesco.org

KeywordsOccurences
read on chester30
additional info chester26
info chester county25
background-repeat no-repeat background-position18
no-repeat background-position left17
chester county commissioners16
background-position left top12
text-decoration none background-repeat12
none background-repeat no-repeat12
read on commissioners8
chester county planning7
county planning commission7
12em font-family montserrat6
county sheriffs office6
text text-decoration none6
font-size 12em font-family6
opioid and heroin6
chester county sheriffs6
read on sheriffs6
chester county read6
text-align left font-style5
montserrat text-align left5
left font-style regular5
regular text-decoration none5
font-style regular text-decoration5
font-family montserrat text-align5
fff font-size 12em5
padding-left 47px background-image5
background-position left center5
color fff font-size5
10px padding-left 47px5
padding-bottom 10px padding-left5
padding-top 10px padding-bottom5
10px padding-bottom 10px5
text color fff5
additional info commissioners5
chester county sheriff5
chester countys department4
county of chester4
director of chester4
color 4a4a4a widgetsearch4
board of commissioners3
chester county hosts3
read on health3
county to participate3
read on county3
department of emergency3
chester county food3
chester county department3
platform to employment3
code blue resources3
county food bank3
county commissioners announce3
county commissioners present3
chester county135
additional info49
info chester26
county commissioners22
no-repeat background-position18
background-repeat no-repeat18
background-position left17
text-decoration none14
left top12
chester countys12
none background-repeat12
sheriffs office11
west chester9
planning commission7
county planning7
commissioners present6
countys department6
text color6
county read6
county sheriffs6
font-size 12em6
12em font-family6
font-family montserrat6
text text-decoration6
county sheriff6
padding-top 10px6
health department6
10px padding-left5
padding-left 47px5
county residents5
padding-bottom 10px5
10px padding-bottom5
district attorney5
info commissioners5
color 4a4a4a5
has been5
47px background-image5
emergency services5
font-style regular5
regular text-decoration5
text-align left5
left font-style5
montserrat text-align5
fff font-size5
left center5
color fff5
economic development4
color 5k4
voter services4
4a4a4a widgetsearch4
awareness month4
mental health4
public health4
center read3
county department3
public safety3
orphans court3
guardian program3
food bank3
photo contest3
county food3
county government3
flood insurance3
county has3
public meeting3
county hosts3
e if3
if ysnsearchonlydept26aa8f42-6277-4a4e-9991-4dcfe5b5346aischecked3
heroin addiction3
sunshine meeting3
blue resources3
code blue3
area businesses3
sonia huntzinger3
day county3
historic preservation3
number0 else3
digital counties3
return false3
commissioners announce3
development council3
if ewhich3
county171
chester161
read77
info51
additional49
commissioners48
countys26
left23
new21
if21
department20
health19
office19
background-repeat18
no-repeat18
background-position18
span18
color17
public17
var17
top16
sheriffs16
services15
center15
program14
none14
residents14
text-decoration14
national14
has13
text12
day12
background-image11
west11
011
10px11
award11
week10
awareness10
survey10
sheriff10
information10
take10
function10
community10
training9
meeting9
development9
else9
true9
emergency9
planning9
event9
government8
association8
font-style8
system8
free8
font-family8
present8
area7
padding-bottom7
font-size7
e7
widgetsearch7
elected7
commission7
receives7
opioid7
padding-top7
check7
montserrat6
receive6
farm6
one6
year6
12em6
text-align6
named6
been6
board6
digital6
preservation6
counties6
director6
up6
month6
first6
16
help6
heroin6
documentreadyfunction6
widgetitem6
index6
have6
return6
us6
widgetbody6
district6
part5
overdose5
25
drug5
may5
attorney5
business5
regular5
47px5
email5
voter5
team5
businesses5
k-95
sep5
economic5
programs5
awards5
4a4a4a5
received5
addiction5
foundation5
farrell5
employment5
fraudulent5
park5
safety5
its5
pa5
seeks5
fff5
during5
pennsylvania5
presented5
padding-left5
mental5
false5
court4
officials4
children4
all4
chair4
agricultural4
guide4
historic4
seminar4
announces4
groups4
recognizes4
local4
dowidgetsearchthisval4
greater4
funds4
which4
were4
wellness4
your4
coatesville4
walk4
slideshow4
launches4
photo4
contest4
second4
resources4
chesco4
5k4
nation4
34
fancybutton250fancybuttonhover4
their4
eshiftkey4
bank4
staff4
announced4
officers4
kichline4
held4
families4
food4
special4
44
cozzone4
menutype3
states3
textstyle13
menu3
american3
enablegoogletranslate3
annual3
members3
excellence3
platform3
organizational3
council3
quicklinksaspx3
page3
little3
united3
huntzinger3
code3
sonia3
healthiest3
march3
intellectual3
passport3
university3
blue3
ratings3
plan3
ewhich3
cookies3
53
63
73
marks3
operation3
home3
comprehensive3
activities3
prescription3
owners3
flood3
property3
open3
unit3
fema3
insurance3
costs3
recently3
kennett3
83
sunshine3
main3
two3
fugitive3
initiative3
commissioner3
notice3
together3
brings3
raise3
participate3
off3
can3
hosts3
education3
technology3
takes3
november3
place3
available3
guard3
site3
bunny3
saturday3
map3
ysnsearchonlydept26aa8f42-6277-4a4e-9991-4dcfe5b5346aischecked3
communities3
support3
phoenixville3
growth3
contact3
evening3
announce3
orphans3
guardian3
crisis3
police3
15px3
93
justice3
display3
friday3
graduates3
we3
applications3
103
number03
trails3
sign3
interested3
deputy3
library3

What are the nameservers for chesco.org?

Chesco.org Domain Nameserver Information

HostIP AddressCountry
ns3.p18.dynect.net 208.78.71.18United States United States
ns1.p18.dynect.net 208.78.70.18United States United States
ns2.p18.dynect.net 204.13.250.18United States United States
ns4.p18.dynect.net 204.13.251.18United States United States

Chesco.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Chesco.org is a scam?