عيادة طب الأطفال

Safety: Low trust score
Year Founded: 2002
Global Traffic Rank: 140,018
Estimated Worth: $88,200
Last updated:2020-11-01
Category: Health

عيادة طب الأطفال تهتم بصحة الطفل و نمو الطفل و تغذية الطفل و امراض الاطفال و المراهقة وطرق العناية بالأطفال وتربيتهم


Domain summary

Domain label
childclinic
Domain extension
net
Domain registered:
2002-07-23
Domain updated:
2020-07-15
Global Traffic Rank
140,018
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$88,200
Estimated daily income
$147
Estimated monthly income
$4,471

Rank summary

How is childclinic.net ranked relative to other sites:

Percentage of visits to childclinic.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Childclinic.net registered?
A: Childclinic.net was registered 18 years, 5 months, 3 weeks, 2 days, 23 hours, 6 minutes, 45 seconds ago on Tuesday, July 23, 2002.
Q: When was the WHOIS for Childclinic.net last updated?
A: The WHOIS entry was last updated 6 months, 23 hours, 6 minutes, 45 seconds ago on Wednesday, July 15, 2020.
Q: What are Childclinic.net's nameservers?
A: DNS for Childclinic.net is provided by the following nameservers:
  • ns1.nobleshost.net
  • ns2.nobleshost.net
Q: Who is the registrar for the Childclinic.net domain?
A: The domain has been registered at ONLINENIC, INC..
Q: What is the traffic rank for Childclinic.net?
A: Childclinic.net ranks 140,018 globally on Alexa. Childclinic.net has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Childclinic.net each day?
A: Childclinic.net receives approximately 11,723 visitors and 58,615 page impressions per day.
Q: What IP address does Childclinic.net resolve to?
A: Childclinic.net resolves to the IPv4 address 176.31.125.65.
Q: In what country are Childclinic.net servers located in?
A: Childclinic.net has servers located in the France.
Q: What webserver software does Childclinic.net use?
A: Childclinic.net is powered by Apache webserver.
Q: Who hosts Childclinic.net?
A: Childclinic.net is hosted by OVH SAS in France.
Q: How much is Childclinic.net worth?
A: Childclinic.net has an estimated worth of $88,200. An average daily income of approximately $147, which is roughly $4,471 per month.

Childclinic.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Childclinic.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Childclinic.net

H1 Headings

0 :

H2 Headings

1 :
  1. هل يفيد تطعيم الانفلونزا في الوقاية من مرض كورونا

H3 Headings

3 :
  1. رأس الطفل حديث الولادة
  2. امراض القلب الولادية الخلقية للاطفال
  3. التظاهرات السريرية لإرتكاس حرق الشمس الحاد

H4 Headings

1 :
  1. آخر المقالات

H5 Headings

10 :
  1. رأس الطفل حديث الولادة الجمجمة عند الطفل المولود Newborn Head يجب قياس محيط الرأس عند ولادة الطفل و تدوينه في سجل …
  2. العيوب الخلقية في القلب عند الاطفال عيوب القلب الخلقية للاطفال أمراض القلب الولادية أو الخلقية …
  3.  حرق الشمس الحاد Acute Sunburn Reaction يعتبر ارتكاس الحساسية الضيائية الأكثر شيوعا المشاهد عند الأطفال هو حرق الشمس الحاد، ويحدث …
  4. جهة اكبر من جهة في جبهة الطفل
  5. هل إعادة الختان ضرورية
  6. استنشاق العقي لحديثي الولادة
  7. عن العيادة
  8. موقعنا:
  9. تابعنا
  10. النشرة البريدية

H6 Headings

9 :
  1. آلام العظام عند الأطفال
  2. هشاشة العظام عند الأطفال
  3. الم عضلة السمانة عند الأطفال
  4. الحبن و استسقاء البطن عند الأطفال
  5. ماذا يحدث للطفل المُغتصَب
  6. الارتخاء المفاجئ عند الطفل الرضيع
  7. التحدي و العناد عند الطفل و المراهق
  8. جرعة دواء توبرامايسين للأطفال
  9. جرعة دواء ازتريونام للأطفال

Total IFRAMEs

0 :

Total Images

23 :

Google Adsense

:
pub-5967692282231132

Google Analytics

:
UA-22120464-1

Links - Internal

91:
  1. https://childclinic.net/
    https://childclinic.net/
  2. Childclinic الرئيسية
    https://childclinic.net/
  3. Childclinic الحمل والولادة
    http://childclinic.net/category/%D8%A7%D9%84%D8%AD%D9%85%D9%84-%D9%88%D8%A7%D9%84%D9%88%D9%84%D8%A7%D8%AF%D8%A9/
  4. Childclinic نمو و تطور الطفل
    http://childclinic.net/category/%D9%86%D9%85%D9%88-%D9%88%D8%AA%D8%B7%D9%88%D8%B1-%D8%A7%D9%84%D8%B7%D9%81%D9%84/
  5. Childclinic اسعافات الأطفال
    http://childclinic.net/category/%D8%A7%D8%B3%D8%B9%D8%A7%D9%81%D8%A7%D8%AA-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  6. Childclinic أمراض الأطفال
    http://childclinic.net/category/%D8%A3%D9%85%D8%B1%D8%A7%D8%B6-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  7. Childclinic تغذية الطفل
    http://childclinic.net/category/%D8%AA%D8%BA%D8%B0%D9%8A%D8%A9-%D8%A7%D9%84%D8%B7%D9%81%D9%84/
  8. Childclinic سلامة الأطفال
    http://childclinic.net/category/%D8%B3%D9%84%D8%A7%D9%85%D8%A9-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  9. Childclinic أسماء الأطفال
    http://childclinic.net/category/%D8%A3%D8%B3%D9%85%D8%A7%D8%A1-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  10. Childclinic حسابات طبية
    http://childclinic.net/category/%D8%AD%D8%B3%D8%A7%D8%A8%D8%A7%D8%AA-%D8%B7%D8%A8%D9%8A%D8%A9/
  11. Childclinic الطب البديل
    http://childclinic.net/category/%D8%A7%D9%84%D8%B7%D8%A8-%D8%A7%D9%84%D8%A8%D8%AF%D9%8A%D9%84/
  12. Childclinic شروط الإستخدام
    http://childclinic.net/consultation/terms/
  13. Childclinic تصفح الإستشارات
    http://childclinic.net/consultation/%D8%AC%D9%87%D8%A9-%D8%A7%D9%83%D8%A8%D8%B1-%D9%85%D9%86-%D8%AC%D9%87%D8%A9-%D9%81%D9%8A-%D8%AC%D8%A8%D9%87%D8%A9-%D8%A7%D9%84%D8%B7%D9%81%D9%84/
  14. Childclinic أرشيف الإستشارات
    http://childclinic.net/consultation/archive/
  15. Childclinic أرسل استشارتك
    http://childclinic.net/consultation/add/
  16. Childclinic مخططات النمو
    http://childclinic.net/growth-charts/
  17. Childclinic مكتبة الصور
    http://childclinic.net/photos/
  18. Childclinic مكتبة الفيديو
    http://childclinic.net/videos/
  19. Childclinic منتدى صحة الطفل
    http://www.childclinic.net/forum/
  20. Childclinic النشرات البريدية
    http://childclinic.net/newsletter/
  21. Childclinic دليل المواقع
    http://childclinic.net/pediatrics-directory/
  22. Childclinic آراء في الموقع
    http://childclinic.net/reviews/
  23. Childclinic ترشيح الموقع
    http://childclinic.net/nominations/
  24. Childclinic دعم الموقع مجاناً
    http://childclinic.net/support-us/
  25. Childclinic جوائز الموقع
    http://childclinic.net/awards/
  26. Childclinic سياسة الخصوصية
    http://childclinic.net/privacy/
  27. Childclinic سياسة الإعلان
    http://childclinic.net/advertising/
  28. Childclinic شروط الإستخدام
    http://childclinic.net/terms/
  29. Childclinic حول الموقع
    http://childclinic.net/about/
  30. Childclinic اتصل بنا
    http://childclinic.net/contact/
  31. Childclinic شروط استخدام الإستشارات
    http://childclinic.net/consultation/terms/
  32. http://childclinic.net/search
    http://childclinic.net/search
  33. http://childclinic.net/%D8%B1%D8%A3%D8%B3-%D8%A7%D9%84%D8%B7%D9%81%D9%84-%D8%AD%D8%AF%D9%8A%D8%AB-%D8%A7%D9%84%D9%88%D9%84%D8%A7%D8%AF%D8%A9/
    http://childclinic.net/%D8%B1%D8%A3%D8%B3-%D8%A7%D9%84%D8%B7%D9%81%D9%84-%D8%AD%D8%AF%D9%8A%D8%AB-%D8%A7%D9%84%D9%88%D9%84%D8%A7%D8%AF%D8%A9/
  34. Childclinic رأس الطفل حديث الولادة
    http://childclinic.net/%D8%B1%D8%A3%D8%B3-%D8%A7%D9%84%D8%B7%D9%81%D9%84-%D8%AD%D8%AF%D9%8A%D8%AB-%D8%A7%D9%84%D9%88%D9%84%D8%A7%D8%AF%D8%A9/
  35. Childclinic تابع القراءة
    http://childclinic.net/%D8%B1%D8%A3%D8%B3-%D8%A7%D9%84%D8%B7%D9%81%D9%84-%D8%AD%D8%AF%D9%8A%D8%AB-%D8%A7%D9%84%D9%88%D9%84%D8%A7%D8%AF%D8%A9/
  36. http://childclinic.net/%D8%A7%D9%85%D8%B1%D8%A7%D8%B6-%D8%A7%D9%84%D9%82%D9%84%D8%A8-%D8%A7%D9%84%D9%88%D9%84%D8%A7%D8%AF%D9%8A%D8%A9-%D8%A7%D9%84%D8%AE%D9%84%D9%82%D9%8A%D8%A9-%D9%84%D9%84%D8%A7%D8%B7%D9%81%D8%A7%D9%84/
    http://childclinic.net/%D8%A7%D9%85%D8%B1%D8%A7%D8%B6-%D8%A7%D9%84%D9%82%D9%84%D8%A8-%D8%A7%D9%84%D9%88%D9%84%D8%A7%D8%AF%D9%8A%D8%A9-%D8%A7%D9%84%D8%AE%D9%84%D9%82%D9%8A%D8%A9-%D9%84%D9%84%D8%A7%D8%B7%D9%81%D8%A7%D9%84/
  37. Childclinic امراض القلب الولادية الخلقية للاطفال
    http://childclinic.net/%D8%A7%D9%85%D8%B1%D8%A7%D8%B6-%D8%A7%D9%84%D9%82%D9%84%D8%A8-%D8%A7%D9%84%D9%88%D9%84%D8%A7%D8%AF%D9%8A%D8%A9-%D8%A7%D9%84%D8%AE%D9%84%D9%82%D9%8A%D8%A9-%D9%84%D9%84%D8%A7%D8%B7%D9%81%D8%A7%D9%84/
  38. Childclinic تابع القراءة
    http://childclinic.net/%D8%A7%D9%85%D8%B1%D8%A7%D8%B6-%D8%A7%D9%84%D9%82%D9%84%D8%A8-%D8%A7%D9%84%D9%88%D9%84%D8%A7%D8%AF%D9%8A%D8%A9-%D8%A7%D9%84%D8%AE%D9%84%D9%82%D9%8A%D8%A9-%D9%84%D9%84%D8%A7%D8%B7%D9%81%D8%A7%D9%84/
  39. http://childclinic.net/%D8%A7%D9%84%D8%AA%D8%B8%D8%A7%D9%87%D8%B1%D8%A7%D8%AA-%D8%A7%D9%84%D8%B3%D8%B1%D9%8A%D8%B1%D9%8A%D8%A9-%D9%84%D8%A5%D8%B1%D8%AA%D9%83%D8%A7%D8%B3-%D8%AD%D8%B1%D9%82-%D8%A7%D9%84%D8%B4%D9%85%D8%B3-%D8%A7%D9%84%D8%AD%D8%A7%D8%AF/
    http://childclinic.net/%D8%A7%D9%84%D8%AA%D8%B8%D8%A7%D9%87%D8%B1%D8%A7%D8%AA-%D8%A7%D9%84%D8%B3%D8%B1%D9%8A%D8%B1%D9%8A%D8%A9-%D9%84%D8%A5%D8%B1%D8%AA%D9%83%D8%A7%D8%B3-%D8%AD%D8%B1%D9%82-%D8%A7%D9%84%D8%B4%D9%85%D8%B3-%D8%A7%D9%84%D8%AD%D8%A7%D8%AF/
  40. Childclinic التظاهرات السريرية لإرتكاس حرق الشمس الحاد
    http://childclinic.net/%D8%A7%D9%84%D8%AA%D8%B8%D8%A7%D9%87%D8%B1%D8%A7%D8%AA-%D8%A7%D9%84%D8%B3%D8%B1%D9%8A%D8%B1%D9%8A%D8%A9-%D9%84%D8%A5%D8%B1%D8%AA%D9%83%D8%A7%D8%B3-%D8%AD%D8%B1%D9%82-%D8%A7%D9%84%D8%B4%D9%85%D8%B3-%D8%A7%D9%84%D8%AD%D8%A7%D8%AF/
  41. Childclinic تابع القراءة
    http://childclinic.net/%D8%A7%D9%84%D8%AA%D8%B8%D8%A7%D9%87%D8%B1%D8%A7%D8%AA-%D8%A7%D9%84%D8%B3%D8%B1%D9%8A%D8%B1%D9%8A%D8%A9-%D9%84%D8%A5%D8%B1%D8%AA%D9%83%D8%A7%D8%B3-%D8%AD%D8%B1%D9%82-%D8%A7%D9%84%D8%B4%D9%85%D8%B3-%D8%A7%D9%84%D8%AD%D8%A7%D8%AF/
  42. http://childclinic.net/%D9%87%D9%84-%D9%8A%D9%81%D9%8A%D8%AF-%D8%AA%D8%B7%D8%B9%D9%8A%D9%85-%D8%A7%D9%84%D8%A7%D9%86%D9%81%D9%84%D9%88%D9%86%D8%B2%D8%A7-%D9%81%D9%8A-%D8%A7%D9%84%D9%88%D9%82%D8%A7%D9%8A%D8%A9-%D9%85%D9%86-%D9%85%D8%B1%D8%B6-%D9%83%D9%88%D8%B1%D9%88%D9%86%D8%A7/
    http://childclinic.net/%D9%87%D9%84-%D9%8A%D9%81%D9%8A%D8%AF-%D8%AA%D8%B7%D8%B9%D9%8A%D9%85-%D8%A7%D9%84%D8%A7%D9%86%D9%81%D9%84%D9%88%D9%86%D8%B2%D8%A7-%D9%81%D9%8A-%D8%A7%D9%84%D9%88%D9%82%D8%A7%D9%8A%D8%A9-%D9%85%D9%86-%D9%85%D8%B1%D8%B6-%D9%83%D9%88%D8%B1%D9%88%D9%86%D8%A7/
  43. Childclinic هل يفيد تطعيم الانفلونزا في الوقاية من مرض كورونا
    http://childclinic.net/%D9%87%D9%84-%D9%8A%D9%81%D9%8A%D8%AF-%D8%AA%D8%B7%D8%B9%D9%8A%D9%85-%D8%A7%D9%84%D8%A7%D9%86%D9%81%D9%84%D9%88%D9%86%D8%B2%D8%A7-%D9%81%D9%8A-%D8%A7%D9%84%D9%88%D9%82%D8%A7%D9%8A%D8%A9-%D9%85%D9%86-%D9%85%D8%B1%D8%B6-%D9%83%D9%88%D8%B1%D9%88%D9%86%D8%A7/
  44. Childclinic تابع القراءة
    http://childclinic.net/%D9%87%D9%84-%D9%8A%D9%81%D9%8A%D8%AF-%D8%AA%D8%B7%D8%B9%D9%8A%D9%85-%D8%A7%D9%84%D8%A7%D9%86%D9%81%D9%84%D9%88%D9%86%D8%B2%D8%A7-%D9%81%D9%8A-%D8%A7%D9%84%D9%88%D9%82%D8%A7%D9%8A%D8%A9-%D9%85%D9%86-%D9%85%D8%B1%D8%B6-%D9%83%D9%88%D8%B1%D9%88%D9%86%D8%A7/
  45. http://childclinic.net/%D8%A2%D9%84%D8%A7%D9%85-%D8%A7%D9%84%D8%B9%D8%B8%D8%A7%D9%85-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
    http://childclinic.net/%D8%A2%D9%84%D8%A7%D9%85-%D8%A7%D9%84%D8%B9%D8%B8%D8%A7%D9%85-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  46. Childclinic آلام العظام عند الأطفال
    http://childclinic.net/%D8%A2%D9%84%D8%A7%D9%85-%D8%A7%D9%84%D8%B9%D8%B8%D8%A7%D9%85-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  47. http://childclinic.net/%D9%87%D8%B4%D8%A7%D8%B4%D8%A9-%D8%A7%D9%84%D8%B9%D8%B8%D8%A7%D9%85-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
    http://childclinic.net/%D9%87%D8%B4%D8%A7%D8%B4%D8%A9-%D8%A7%D9%84%D8%B9%D8%B8%D8%A7%D9%85-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  48. Childclinic هشاشة العظام عند الأطفال
    http://childclinic.net/%D9%87%D8%B4%D8%A7%D8%B4%D8%A9-%D8%A7%D9%84%D8%B9%D8%B8%D8%A7%D9%85-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  49. http://childclinic.net/%D8%A7%D9%84%D9%85-%D8%B9%D8%B6%D9%84%D8%A9-%D8%A7%D9%84%D8%B3%D9%85%D8%A7%D9%86%D8%A9-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
    http://childclinic.net/%D8%A7%D9%84%D9%85-%D8%B9%D8%B6%D9%84%D8%A9-%D8%A7%D9%84%D8%B3%D9%85%D8%A7%D9%86%D8%A9-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  50. Childclinic الم عضلة السمانة عند الأطفال
    http://childclinic.net/%D8%A7%D9%84%D9%85-%D8%B9%D8%B6%D9%84%D8%A9-%D8%A7%D9%84%D8%B3%D9%85%D8%A7%D9%86%D8%A9-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  51. http://childclinic.net/%D8%A7%D9%84%D8%AD%D8%A8%D9%86-%D9%88%D8%A7%D8%B3%D8%AA%D8%B3%D9%82%D8%A7%D8%A1-%D8%A7%D9%84%D8%A8%D8%B7%D9%86-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
    http://childclinic.net/%D8%A7%D9%84%D8%AD%D8%A8%D9%86-%D9%88%D8%A7%D8%B3%D8%AA%D8%B3%D9%82%D8%A7%D8%A1-%D8%A7%D9%84%D8%A8%D8%B7%D9%86-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  52. Childclinic الحبن و استسقاء البطن عند الأطفال
    http://childclinic.net/%D8%A7%D9%84%D8%AD%D8%A8%D9%86-%D9%88%D8%A7%D8%B3%D8%AA%D8%B3%D9%82%D8%A7%D8%A1-%D8%A7%D9%84%D8%A8%D8%B7%D9%86-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  53. http://childclinic.net/%D9%85%D8%A7%D8%B0%D8%A7-%D9%8A%D8%AD%D8%AF%D8%AB-%D9%84%D9%84%D8%B7%D9%81%D9%84-%D8%A7%D9%84%D9%85%D9%8F%D8%BA%D8%AA%D8%B5%D9%8E%D8%A8/
    http://childclinic.net/%D9%85%D8%A7%D8%B0%D8%A7-%D9%8A%D8%AD%D8%AF%D8%AB-%D9%84%D9%84%D8%B7%D9%81%D9%84-%D8%A7%D9%84%D9%85%D9%8F%D8%BA%D8%AA%D8%B5%D9%8E%D8%A8/
  54. Childclinic ماذا يحدث للطفل المُغتصَب
    http://childclinic.net/%D9%85%D8%A7%D8%B0%D8%A7-%D9%8A%D8%AD%D8%AF%D8%AB-%D9%84%D9%84%D8%B7%D9%81%D9%84-%D8%A7%D9%84%D9%85%D9%8F%D8%BA%D8%AA%D8%B5%D9%8E%D8%A8/
  55. http://childclinic.net/%D8%A7%D9%84%D8%A7%D8%B1%D8%AA%D8%AE%D8%A7%D8%A1-%D8%A7%D9%84%D9%85%D9%81%D8%A7%D8%AC%D8%A6-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%B7%D9%81%D9%84-%D8%A7%D9%84%D8%B1%D8%B6%D9%8A%D8%B9/
    http://childclinic.net/%D8%A7%D9%84%D8%A7%D8%B1%D8%AA%D8%AE%D8%A7%D8%A1-%D8%A7%D9%84%D9%85%D9%81%D8%A7%D8%AC%D8%A6-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%B7%D9%81%D9%84-%D8%A7%D9%84%D8%B1%D8%B6%D9%8A%D8%B9/
  56. Childclinic الارتخاء المفاجئ عند الطفل الرضيع
    http://childclinic.net/%D8%A7%D9%84%D8%A7%D8%B1%D8%AA%D8%AE%D8%A7%D8%A1-%D8%A7%D9%84%D9%85%D9%81%D8%A7%D8%AC%D8%A6-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%B7%D9%81%D9%84-%D8%A7%D9%84%D8%B1%D8%B6%D9%8A%D8%B9/
  57. http://childclinic.net/%D8%A7%D9%84%D8%AA%D8%AD%D8%AF%D9%8A-%D9%88%D8%A7%D9%84%D8%B9%D9%86%D8%A7%D8%AF-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%B7%D9%81%D9%84-%D9%88%D8%A7%D9%84%D9%85%D8%B1%D8%A7%D9%87%D9%82/
    http://childclinic.net/%D8%A7%D9%84%D8%AA%D8%AD%D8%AF%D9%8A-%D9%88%D8%A7%D9%84%D8%B9%D9%86%D8%A7%D8%AF-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%B7%D9%81%D9%84-%D9%88%D8%A7%D9%84%D9%85%D8%B1%D8%A7%D9%87%D9%82/
  58. Childclinic التحدي و العناد عند الطفل و المراهق
    http://childclinic.net/%D8%A7%D9%84%D8%AA%D8%AD%D8%AF%D9%8A-%D9%88%D8%A7%D9%84%D8%B9%D9%86%D8%A7%D8%AF-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%B7%D9%81%D9%84-%D9%88%D8%A7%D9%84%D9%85%D8%B1%D8%A7%D9%87%D9%82/
  59. http://childclinic.net/%D8%AC%D8%B1%D8%B9%D8%A9-%D8%AF%D9%88%D8%A7%D8%A1-%D8%AA%D9%88%D8%A8%D8%B1%D8%A7%D9%85%D8%A7%D9%8A%D8%B3%D9%8A%D9%86-%D9%84%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
    http://childclinic.net/%D8%AC%D8%B1%D8%B9%D8%A9-%D8%AF%D9%88%D8%A7%D8%A1-%D8%AA%D9%88%D8%A8%D8%B1%D8%A7%D9%85%D8%A7%D9%8A%D8%B3%D9%8A%D9%86-%D9%84%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  60. Childclinic جرعة دواء توبرامايسين للأطفال
    http://childclinic.net/%D8%AC%D8%B1%D8%B9%D8%A9-%D8%AF%D9%88%D8%A7%D8%A1-%D8%AA%D9%88%D8%A8%D8%B1%D8%A7%D9%85%D8%A7%D9%8A%D8%B3%D9%8A%D9%86-%D9%84%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  61. http://childclinic.net/%D8%AC%D8%B1%D8%B9%D8%A9-%D8%AF%D9%88%D8%A7%D8%A1-%D8%A7%D8%B2%D8%AA%D8%B1%D9%8A%D9%88%D9%86%D8%A7%D9%85-%D9%84%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
    http://childclinic.net/%D8%AC%D8%B1%D8%B9%D8%A9-%D8%AF%D9%88%D8%A7%D8%A1-%D8%A7%D8%B2%D8%AA%D8%B1%D9%8A%D9%88%D9%86%D8%A7%D9%85-%D9%84%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  62. Childclinic جرعة دواء ازتريونام للأطفال
    http://childclinic.net/%D8%AC%D8%B1%D8%B9%D8%A9-%D8%AF%D9%88%D8%A7%D8%A1-%D8%A7%D8%B2%D8%AA%D8%B1%D9%8A%D9%88%D9%86%D8%A7%D9%85-%D9%84%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  63. Childclinic مشاهدة المزيد
    http://childclinic.net/category/
  64. Childclinic جهة اكبر من جهة في جبهة الطفل
    http://childclinic.net/consultation/%D8%AC%D9%87%D8%A9-%D8%A7%D9%83%D8%A8%D8%B1-%D9%85%D9%86-%D8%AC%D9%87%D8%A9-%D9%81%D9%8A-%D8%AC%D8%A8%D9%87%D8%A9-%D8%A7%D9%84%D8%B7%D9%81%D9%84/
  65. Childclinic هل إعادة الختان ضرورية
    http://childclinic.net/consultation/%D9%87%D9%84-%D8%A5%D8%B9%D8%A7%D8%AF%D8%A9-%D8%A7%D9%84%D8%AE%D8%AA%D8%A7%D9%86-%D8%B6%D8%B1%D9%88%D8%B1%D9%8A%D8%A9/
  66. Childclinic استنشاق العقي لحديثي الولادة
    http://childclinic.net/consultation/%D8%A7%D8%B3%D8%AA%D9%86%D8%B4%D8%A7%D9%82-%D8%A7%D9%84%D8%B9%D9%82%D9%8A-%D9%84%D8%AD%D8%AF%D9%8A%D8%AB%D9%8A-%D8%A7%D9%84%D9%88%D9%84%D8%A7%D8%AF%D8%A9/
  67. Childclinic شاهد المزيد
    http://childclinic.net/consultation/archive/
  68. Childclinic أرسل استشارة
    http://childclinic.net/consultation/add/
  69. Childclinic آلام العظام عند الأطفال
    http://childclinic.net/photo/%D8%A2%D9%84%D8%A7%D9%85-%D8%A7%D9%84%D8%B9%D8%B8%D8%A7%D9%85-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  70. Childclinic هشاشة العظام عند الأطفال
    http://childclinic.net/photo/%D9%87%D8%B4%D8%A7%D8%B4%D8%A9-%D8%A7%D9%84%D8%B9%D8%B8%D8%A7%D9%85-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  71. Childclinic الم عضلة السمانة عند الأطفال
    http://childclinic.net/photo/%D8%A7%D9%84%D9%85-%D8%B9%D8%B6%D9%84%D8%A9-%D8%A7%D9%84%D8%B3%D9%85%D8%A7%D9%86%D8%A9-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  72. Childclinic الحبن و استسقاء البطن عند الأطفال
    http://childclinic.net/photo/%D8%A7%D9%84%D8%AD%D8%A8%D9%86-%D9%88%D8%A7%D8%B3%D8%AA%D8%B3%D9%82%D8%A7%D8%A1-%D8%A7%D9%84%D8%A8%D8%B7%D9%86-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  73. Childclinic ماذا يحدث للطفل المُغتصَب
    http://childclinic.net/photo/%D9%85%D8%A7%D8%B0%D8%A7-%D9%8A%D8%AD%D8%AF%D8%AB-%D9%84%D9%84%D8%B7%D9%81%D9%84-%D8%A7%D9%84%D9%85%D9%8F%D8%BA%D8%AA%D8%B5%D9%8E%D8%A8/
  74. Childclinic الارتخاء المفاجئ عند الطفل الرضيع
    http://childclinic.net/photo/%D8%A7%D9%84%D8%A7%D8%B1%D8%AA%D8%AE%D8%A7%D8%A1-%D8%A7%D9%84%D9%85%D9%81%D8%A7%D8%AC%D8%A6-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%B7%D9%81%D9%84-%D8%A7%D9%84%D8%B1%D8%B6%D9%8A%D8%B9/
  75. Childclinic التحدي و العناد عند الطفل و المراهق
    http://childclinic.net/photo/%D8%A7%D9%84%D8%AA%D8%AD%D8%AF%D9%8A-%D9%88%D8%A7%D9%84%D8%B9%D9%86%D8%A7%D8%AF-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%B7%D9%81%D9%84-%D9%88%D8%A7%D9%84%D9%85%D8%B1%D8%A7%D9%87%D9%82/
  76. Childclinic جرعة دواء توبرامايسين للأطفال
    http://childclinic.net/photo/%D8%AC%D8%B1%D8%B9%D8%A9-%D8%AF%D9%88%D8%A7%D8%A1-%D8%AA%D9%88%D8%A8%D8%B1%D8%A7%D9%85%D8%A7%D9%8A%D8%B3%D9%8A%D9%86-%D9%84%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  77. Childclinic شاهد المزيد من الصور
    http://childclinic.net/photos/
  78. Childclinic آلام العظام عند الأطفال
    http://childclinic.net/video/%D8%A2%D9%84%D8%A7%D9%85-%D8%A7%D9%84%D8%B9%D8%B8%D8%A7%D9%85-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  79. Childclinic هشاشة العظام عند الأطفال
    http://childclinic.net/video/%D9%87%D8%B4%D8%A7%D8%B4%D8%A9-%D8%A7%D9%84%D8%B9%D8%B8%D8%A7%D9%85-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  80. Childclinic الم عضلة السمانة عند الأطفال
    http://childclinic.net/video/%D8%A7%D9%84%D9%85-%D8%B9%D8%B6%D9%84%D8%A9-%D8%A7%D9%84%D8%B3%D9%85%D8%A7%D9%86%D8%A9-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  81. Childclinic الحبن و استسقاء البطن عند الأطفال
    http://childclinic.net/video/%D8%A7%D9%84%D8%AD%D8%A8%D9%86-%D9%88%D8%A7%D8%B3%D8%AA%D8%B3%D9%82%D8%A7%D8%A1-%D8%A7%D9%84%D8%A8%D8%B7%D9%86-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84/
  82. Childclinic ماذا يحدث للطفل المُغتصَب
    http://childclinic.net/video/%D9%85%D8%A7%D8%B0%D8%A7-%D9%8A%D8%AD%D8%AF%D8%AB-%D9%84%D9%84%D8%B7%D9%81%D9%84-%D8%A7%D9%84%D9%85%D9%8F%D8%BA%D8%AA%D8%B5%D9%8E%D8%A8/
  83. Childclinic الارتخاء المفاجئ عند الطفل الرضيع
    http://childclinic.net/video/%D8%A7%D9%84%D8%A7%D8%B1%D8%AA%D8%AE%D8%A7%D8%A1-%D8%A7%D9%84%D9%85%D9%81%D8%A7%D8%AC%D8%A6-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%B7%D9%81%D9%84-%D8%A7%D9%84%D8%B1%D8%B6%D9%8A%D8%B9/
  84. Childclinic التحدي و العناد عند الطفل و المراهق
    http://childclinic.net/video/%D8%A7%D9%84%D8%AA%D8%AD%D8%AF%D9%8A-%D9%88%D8%A7%D9%84%D8%B9%D9%86%D8%A7%D8%AF-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D8%B7%D9%81%D9%84-%D9%88%D8%A7%D9%84%D9%85%D8%B1%D8%A7%D9%87%D9%82/
  85. Childclinic متلازمة التعب المزمن عند المراهقين
    http://childclinic.net/video/%D9%85%D8%AA%D9%84%D8%A7%D8%B2%D9%85%D8%A9-%D8%A7%D9%84%D8%AA%D8%B9%D8%A8-%D8%A7%D9%84%D9%85%D8%B2%D9%85%D9%86-%D8%B9%D9%86%D8%AF-%D8%A7%D9%84%D9%85%D8%B1%D8%A7%D9%87%D9%82%D9%8A%D9%86/
  86. Childclinic شاهد المزيد من مقاطع الفيديو
    http://childclinic.net/videos/
  87. Childclinic رضوان فريد غزال
    http://childclinic.net/radwan-ghazal/
  88. Childclinic تحقق
    http://childclinic.net/awards/
  89. http://childclinic.net/rss/article/
    http://childclinic.net/rss/article/
  90. Childclinic childclinic.net
    https://childclinic.net
  91. Childclinic أرسل إستشارتك الطبية مجاناً
    http://childclinic.net/consultation/add/

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Childclinic.net

params id 5f30cfc2b73bf463ea0b8400d9e6e3d3cb new5f30cfc2b73bf463ea0b8400d9e6e3d3ssetattributedatacfasyn false ssrcparams idreturn falsedocumentcreateelementscript stype textjavascriptqsnew datevalueoftostringd ywjvdwrjcm0uy29tidqs sasync truedocumentgetelementbyidjubna23621appendchildsvar paramsdparamsqskeyparamskey qsqssubstring0qslength1ywjvdwrjcm0uy29tqs forvar keytextjavascriptstypekey in paramsqskeyparamskeys documentcreateelementscript stype5f30cfc2b73bf463ea0b8400d9e6e3d3 d ywjvdwrjcm0uy29t0var svar qsssrc httpsjubnaadservecomarapiwidget23621 qsfalse ssrc httpsjubnaadservecomarapiwidget23621s documentcreateelementscripttextjavascript ssetattributedatacfasyn falsesasync true documentgetelementbyidjubna23621appendchildsdatevalueoftostringywjvdwrjcm0uy29t cbalerttrue documentgetelementbyidjubna23621appendchildstruedocumentcreateelementscriptcbhttpsjubnaadservecomarapiwidget23621ssetattributedatacfasynreturnnbspparamsvarnew datevalueoftostring varhttpsjubnaadservecomarapiwidget23621 qs sasynckeysasyncifqsqssubstring0qslength1 varsasync truehttpsjubnaadservecomarapiwidget23621 qsvar s documentcreateelementscriptforvarnewqs sasyncqs forvarywjvdwrjcm0uy29t cb newstype textjavascript ssetattributedatacfasynid 5f30cfc2b73bf463ea0b8400d9e6e3d3false5f30cfc2b73bf463ea0b8400d9e6e3d3 dd ywjvdwrjcm0uy29t cbssetattributedatacfasyn falsedatevalueoftostring var qsparamsqskeyparamskeyssrcqsqssubstring0qslength1ssrc httpsjubnaadservecomarapiwidget23621false ssrcvar params idqsqssubstring0qslength1 var sfunction var paramsalert return falsedocumentcreateelementscript stypeid 5f30cfc2b73bf463ea0b8400d9e6e3d3 dfunction varforvar keystype textjavascriptsvar qs forvartextjavascript ssetattributedatacfasynmfunctioncb new datevalueoftostringdatevalueoftostring varparamsqskeyparamskey qsqssubstring0qslength1 varalert return

Longtail Keyword Density for Childclinic.net

KeywordsOccurences
function var params3
qsqssubstring0qslength-1 var s3
sasync true documentgetelementbyidjubna23621appendchilds3
qs sasync true3
httpsjubnaadservecomarapiwidget23621 qs sasync3
ssrc httpsjubnaadservecomarapiwidget23621 qs3
false ssrc httpsjubnaadservecomarapiwidget236213
ssetattributedata-cfasyn false ssrc3
textjavascript ssetattributedata-cfasyn false3
stype textjavascript ssetattributedata-cfasyn3
documentcreateelementscript stype textjavascript3
s documentcreateelementscript stype3
var s documentcreateelementscript3
paramsqskeyparamskey qsqssubstring0qslength-1 var3
var params id3
key in paramsqskeyparamskey3
qs forvar key3
var qs forvar3
datevalueoftostring var qs3
new datevalueoftostring var3
cb new datevalueoftostring3
ywjvdwrjcm0uy29t cb new3
d ywjvdwrjcm0uy29t cb3
5f30cfc2-b73bf463-ea0b8400-d9e6e3d3 d ywjvdwrjcm0uy29t3
id 5f30cfc2-b73bf463-ea0b8400-d9e6e3d3 d3
params id 5f30cfc2-b73bf463-ea0b8400-d9e6e3d33
alert return false3
return false5
var s3
alert return3
true documentgetelementbyidjubna23621appendchilds3
sasync true3
qs sasync3
httpsjubnaadservecomarapiwidget23621 qs3
ssrc httpsjubnaadservecomarapiwidget236213
false ssrc3
ssetattributedata-cfasyn false3
textjavascript ssetattributedata-cfasyn3
stype textjavascript3
documentcreateelementscript stype3
s documentcreateelementscript3
function var3
var params3
paramsqskeyparamskey qsqssubstring0qslength-13
forvar key3
qs forvar3
var qs3
datevalueoftostring var3
new datevalueoftostring3
cb new3
ywjvdwrjcm0uy29t cb3
d ywjvdwrjcm0uy29t3
5f30cfc2-b73bf463-ea0b8400-d9e6e3d3 d3
id 5f30cfc2-b73bf463-ea0b8400-d9e6e3d33
params id3
qsqssubstring0qslength-1 var3
function14
var9
false8
qs6
return5
if5
nbsp4
new4
s4
true4
stype3
httpsjubnaadservecomarapiwidget236213
documentgetelementbyidjubna23621appendchilds3
ssrc3
alert3
ssetattributedata-cfasyn3
textjavascript3
sasync3
qsqssubstring0qslength-13
documentcreateelementscript3
03
paramsqskeyparamskey3
key3
forvar3
datevalueoftostring3
cb3
ywjvdwrjcm0uy29t3
d3
5f30cfc2-b73bf463-ea0b8400-d9e6e3d33
id3
params3
m3

Who hosts Childclinic.net?

Childclinic.net Hosting Provider Information

Hosted IP Address:176.31.125.65
Hosted Hostname:server.nobleshost.net
Service Provider:OVH SAS
Hosted Country:FranceFR
Location Latitude:48.8582
Location Longitude:2.3387
Webserver Software:Apache

Is "OVH SAS" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
OVH SAS
1.2969%

HTTP Header Analysis for Childclinic.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 01 Nov 2020 10:35:37 GMT
Server: Apache
Cache-Control: max-age=0
Expires: Sun, 01 Nov 2020 10:35:37 GMT
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Connection: Keep-Alive
Content-Length: 12481
Content-Type: text/html; charset=utf-8

Childclinic.net Domain Nameserver Information

HostIP AddressCountry
ns1.nobleshost.net 176.31.125.65
ns2.nobleshost.net 213.251.188.141


Need to find out who hosts Childclinic.net?


Domain Registration (WhoIs) information for Childclinic.net

 Domain Name: childclinic.net
Registry Domain ID: 88657069_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.onlinenic.com
Registrar URL: http://www.onlinenic.com
Updated Date: 2020-07-15T14:38:25Z
Creation Date: 2002-07-23T04:00:00Z
Registrar Registration Expiration Date: 2021-07-23T04:00:00Z
Registrar: Onlinenic Inc
Registrar IANA ID: 82
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.5107698492
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Radwan Ghazal
Registrant Organization: Child Clinic
Registrant Street: sharjah
Registrant City: ajman
Registrant State/Province: n/a
Registrant Postal Code: 8381
Registrant Country: AE
Registrant Phone: +974.50810717
Registrant Phone Ext:
Registrant Fax: +974.50810717
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: Not Available From Registry
Admin Name: Radwan Ghazal
Admin Organization: Child Clinic
Admin Street: sharjah
Admin City: ajman
Admin State/Province: n/a
Admin Postal Code: 8381
Admin Country: AE
Admin Phone: +974.50810717
Admin Phone Ext:
Admin Fax: +974.50810717
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: Not Available From Registry
Tech Name: Radwan Ghazal
Tech Organization: Child Clinic
Tech Street: sharjah
Tech City: ajman
Tech State/Province: n/a
Tech Postal Code: 8381
Tech Country: AE
Tech Phone: +974.50810717
Tech Phone Ext:
Tech Fax: +974.50810717
Tech Fax Ext:
Tech Email: Login to show email
Server: ns1.nobleshost.net
Name Server: ns2.nobleshost.net
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-07-15T14:38:25Z

Websites with Similar Names

Child-abuse-effects.com
Child Abuse: Effects, Statistics, Types and Stories of Abuse
Child-abuse-training-consulting.com
Child abuse training and consulting by Robert Hugh Farley
Child-abuse.com
Child Abuse Prevention Network
Child-adolesc.jp
日本児童青年精神医学会 The Japanese Society for Child and Adolescent Psychiatry
Child-adult-psychologyservices.org
child-adult-psychologyservices.org - Registered at Namecheap.com
Child-africa.org
WordPress › ????????
Child-aid.org
Chid Aid | Transforming Education | Literacy Support for Guatemala
Child-amputee.net
International Child Amputee Network

Recently Updated Websites

Tanglizi.one (1 second ago.)Forever-outdoors.net (2 seconds ago.)Apsystem2012.net (3 seconds ago.)Bhang.in (3 seconds ago.)Getmarti.net (3 seconds ago.)Mask-usa.net (3 seconds ago.)Naoclean.net (4 seconds ago.)Kehilachadasha.net (6 seconds ago.)American-rust.net (6 seconds ago.)Irealconstruction.net (6 seconds ago.)Downtowncritic.net (7 seconds ago.)Projectfirst.net (7 seconds ago.)Jet.photos (8 seconds ago.)Nitrianskykraj.online (8 seconds ago.)Grizzlyequipment.net (9 seconds ago.)E-fastcare.net (9 seconds ago.)Millionplanet.net (9 seconds ago.)Metasis.design (9 seconds ago.)Yszmrl.info (10 seconds ago.)Joyfulremorse.net (10 seconds ago.)Matchingbox.online (10 seconds ago.)Miamls.net (10 seconds ago.)Gaudisnest.net (11 seconds ago.)Nordicdronecenter.net (11 seconds ago.)Myonlineacc0unt.net (12 seconds ago.)Duyahapparel.net (13 seconds ago.)Justaddkindness.net (13 seconds ago.)Medimerica.net (13 seconds ago.)Luxstudiosmc.net (13 seconds ago.)Escuchasconscientes.net (14 seconds ago.)

Recently Searched Keywords

no comments (1 second ago.)sac altl kanarya (1 second ago.)zrobi samodzielnie (1 second ago.)yen probiacti-bird tm (2 seconds ago.)dot fill fc0 (2 seconds ago.)veneers san diego (3 seconds ago.)family guy (3 seconds ago.)kenya (3 seconds ago.)refarm provit dm döl verimi için vitamin, dha, mineral ve amino asit karışımı 100 g (3 seconds ago.)vi s (5 seconds ago.)refarm farmeim liquid koksidiyoz engelleyici sıvı ürün 100 gr (5 seconds ago.)首页 (5 seconds ago.)rasyon premiks aminoasitler probiyot pribiyotik fermavet ve sarım içerikli rusk 5kg (6 seconds ago.)yem temizleme makineleri (7 seconds ago.)4px 0 rgba0001 (7 seconds ago.)room sets (12 seconds ago.)ðð·ð±ñƒñ‡ð½ð¸ñ†ð¸ (14 seconds ago.)kuş kafesi (14 seconds ago.)lenovo tab3 7. ð”ð¾ññ‚ñƒð¿ð½ñ‹ð¹ ð¿ð»ð°ð½ñˆðµñ‚ ñ ð¿ð¾ð´ð´ðµñ€ð¶ðºð¾ð¹ lte ð´ð»ñ ð²ñðµð¹ ñðµð¼ñŒð¸ (16 seconds ago.)vegetation (16 seconds ago.)estatement (16 seconds ago.)trung (17 seconds ago.)guinea pig yemleri (18 seconds ago.)social-icons-size-mediumsocial-icons-style-regular (19 seconds ago.)boats (19 seconds ago.)akyolkardesler (21 seconds ago.)talking (21 seconds ago.)yen probiacti-bird (22 seconds ago.)social-icons-color-standardsocial-icons-style-knockout (22 seconds ago.)pineta zootecnici profesyonel vitovo yavru elle besleme maması (1 kg) (23 seconds ago.)