Chubb.co.nz

Website Thumbnail
Checking...
Chubb New Zealand | Chubb Fire Safety | Chubb Security | Alarms | Locksmiths

Safety: Low trust score
Year Founded: 1996
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-28
Category: This site has not been categorized yet

Chubb is a leading provider of fire protection systems, fire fighting products, locksmiths and safe products, business and home security solutions and alarm monitoring services in New Zealand. Contact Chubb for reliable, experienced service.

chubb, fire protection, fire safety, chubb, chubb fire and security, fire extinguisher, fire hydrant, fire marshal training, ip cctv, fire order safety, fire suppression, health safety act, cctv systems, fire extinguishing types, fire risk assessment, safety signs, fire exit signs, cctv camera, disability act, employees liability, coshh, security systems, security solutions, fire procedures, purafoam®, l g®, aritech®, fry fighter®, hydrospray®, hydrospray elite®, pyromet®, chubb multiway®, hosemaster®, careunity®, chubb® fx range, chubb® econnect, chubb® care call, chubb® care systems, equality act, fire equipment servicing and maintenance, security equipment servicing and maintenance, fire equipment monitoring, security equipment monitoring, telecare monitoring, telecare service and maintenance, chubb® care control, chubb® control view, chubb® service check cctv  Show all keywords

Domain summary

Domain label
chubb
Domain extension
co.nz
Domain registered:
1996-10-12
Domain updated:
2019-12-22
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is chubb.co.nz ranked relative to other sites:

Percentage of visits to chubb.co.nz from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Chubb.co.nz registered?
A: Chubb.co.nz was registered 24 years, 1 month, 2 weeks, 2 days, 17 hours, 35 minutes, 38 seconds ago on Saturday, October 12, 1996.
Q: When was the WHOIS for Chubb.co.nz last updated?
A: The WHOIS entry was last updated 11 months, 6 days, 17 hours, 35 minutes, 38 seconds ago on Sunday, December 22, 2019.
Q: What are Chubb.co.nz's nameservers?
A: DNS for Chubb.co.nz is provided by the following nameservers:
  • tricia.ns.cloudflare.com
  • gabe.ns.cloudflare.com
Q: Who is the registrar for the Chubb.co.nz domain?
A: The domain has been registered at New Zealand Domain Name Registry Limited.
Q: What is the traffic rank for Chubb.co.nz?
A: Chubb.co.nz has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Chubb.co.nz each day?
A: Chubb.co.nz receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Chubb.co.nz resolve to?
A: Chubb.co.nz resolves to the IPv4 address 104.18.8.84.
Q: In what country are Chubb.co.nz servers located in?
A: Chubb.co.nz has servers located in the United States.
Q: What webserver software does Chubb.co.nz use?
A: Chubb.co.nz is powered by CloudFlare webserver.
Q: Who hosts Chubb.co.nz?
A: Chubb.co.nz is hosted by CloudFlare, Inc. in United States.
Q: How much is Chubb.co.nz worth?
A: Chubb.co.nz has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Chubb.co.nz Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Chubb.co.nz Free SEO Report

Website Inpage Analysis for Chubb.co.nz

H1 Headings

1 :
  1. Fire Protection

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

31 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-21761042-87

Links - Internal

70:
  1. http://chubb.co.nz/en/nz/
    http://chubb.co.nz/en/nz/
  2. Chubb View all Fire Protection products and services
    http://chubb.co.nz/en/nz/products/fire-protection/
  3. Chubb Fire service and maintenance
    http://chubb.co.nz/en/nz/products/fire-protection/fire-service-maintenance/
  4. Chubb Emergency plans and training
    http://chubb.co.nz/en/nz/products/fire-protection/fire-safety-training/
  5. Chubb Fire detection and suppression
    http://chubb.co.nz/en/nz/products/fire-protection/fire-detection-suppression/
  6. Chubb Rescue products and hazmat
    http://chubb.co.nz/en/nz/products/fire-protection/rescue-products-hazmat/
  7. Chubb Fire extinguisher service
    http://chubb.co.nz/en/nz/products/fire-protection/fire-extinguisher-service/
  8. Chubb Building compliance
    http://chubb.co.nz/en/nz/products/fire-protection/building-compliance/
  9. Chubb Fire licensing & accreditations
    http://chubb.co.nz/en/nz/products/fire-protection/legislation-standards/
  10. Chubb Emergency & Exit Lighting
    http://chubb.co.nz/en/nz/products/fire-protection/emergency-exit-lighting/
  11. Chubb View all security solutions for your business
    http://chubb.co.nz/en/nz/products/commercial-security/
  12. Chubb Video surveillance
    http://chubb.co.nz/en/nz/products/commercial-security/video-surveillance/
  13. Chubb Intruder alarms
    http://chubb.co.nz/en/nz/products/commercial-security/intruder-alarms/
  14. Chubb Access control
    http://chubb.co.nz/en/nz/products/commercial-security/access-control/
  15. Chubb Integrated security solutions
    http://chubb.co.nz/en/nz/products/commercial-security/integrated-systems/
  16. Chubb Chubb service and maintenance
    http://chubb.co.nz/en/nz/products/commercial-security/service-and-maintenance/
  17. Chubb Security licencing and standards
    http://chubb.co.nz/en/nz/products/commercial-security/licencing-and-standards/
  18. Chubb Security audit
    http://chubb.co.nz/en/nz/products/commercial-security/security-audit/
  19. Chubb Moving premises?
    http://chubb.co.nz/en/nz/products/commercial-security/moving-premises/
  20. Chubb Visit the Chubb home security website open_in_new
    http://security.chubb.co.nz/
  21. Chubb View all locks & safes products and services
    http://chubb.co.nz/en/nz/products/locks-safes/
  22. Chubb Find a locksmith
    http://chubb.co.nz/en/nz/products/locks-safes/find-locksmith/
  23. Chubb Key request
    http://chubb.co.nz/en/nz/products/locks-safes/key-request/
  24. Chubb Restricted key systems
    http://chubb.co.nz/en/nz/products/locks-safes/restricted-key-systems/
  25. Chubb Safe products
    http://chubb.co.nz/en/nz/products/locks-safes/safe-products/
  26. Chubb See all Industry Solutions keyboard_arrow_right
    http://chubb.co.nz/en/nz/industries/
  27. Chubb Banking
    http://chubb.co.nz/en/nz/industries/banking-finance/
  28. Chubb Commercial and office buildings
    http://chubb.co.nz/en/nz/industries/commercial-office/
  29. Chubb Education
    http://chubb.co.nz/en/nz/industries/education/
  30. Chubb Government and public sector
    http://chubb.co.nz/en/nz/industries/government-public-sector/
  31. Chubb Healthcare
    http://chubb.co.nz/en/nz/industries/healthcare/
  32. Chubb Industry and manufacturing
    http://chubb.co.nz/en/nz/industries/industry-manufacturing/
  33. Chubb Mining, oil and gas
    http://chubb.co.nz/en/nz/industries/mining-oil-gas/
  34. Chubb Retail
    http://chubb.co.nz/en/nz/industries/retail/
  35. Chubb Specialist infrastructure
    http://chubb.co.nz/en/nz/industries/specialist-infrastructure/
  36. Chubb Chubb eStore
    http://store.chubb.co.nz/
  37. Chubb Visit the eStore open_in_new
    http://store.chubb.co.nz/
  38. Chubb About us
    http://chubb.co.nz/en/nz/about/
  39. Chubb Global locations
    http://chubb.co.nz/en/nz/about/global-locations/
  40. Chubb History
    http://chubb.co.nz/en/nz/about/history/
  41. Chubb Core values
    http://chubb.co.nz/en/nz/about/core-values/
  42. Chubb Quality Certification
    http://chubb.co.nz/en/nz/about/quality-certification/
  43. Chubb contact us
    http://chubb.co.nz/en/nz/contact
  44. Chubb Email
    http://chubb.co.nz/en/nz/contact/email/
  45. Chubb Call
    http://chubb.co.nz/en/nz/contact/call-us/
  46. Chubb New Zealand locations
    http://chubb.co.nz/en/nz/contact/locations/
  47. Chubb Update monitoring details
    http://chubb.co.nz/en/nz/contact/update-monitoring-contact-details/
  48. Chubb Learn more
    http://chubb.co.nz/en/nz/products/fire-protection/
  49. Chubb Learn more
    http://chubb.co.nz/en/nz/products/commercial-security/
  50. Chubb Learn more
    http://chubb.co.nz/en/nz/products/commercial-security/intruder-alarm-monitoring/
  51. Chubb Learn more open_in_new Opens in a new window
    http://security.chubb.co.nz/
  52. Chubb See our timeline
    http://chubb.co.nz/en/nz/media/HQGCom1823ENa-Chubb-200-year-timeline_v2_tcm527-41921.pdf
  53. http://chubb.co.nz/en/nz/products/fire-protection/
    http://chubb.co.nz/en/nz/products/fire-protection/
  54. http://chubb.co.nz/en/nz/products/commercial-security/
    http://chubb.co.nz/en/nz/products/commercial-security/
  55. http://chubb.co.nz/en/nz/products/locks-safes/
    http://chubb.co.nz/en/nz/products/locks-safes/
  56. Chubb Learn more
    http://chubb.co.nz/en/nz/products/locks-safes/
  57. Chubb Learn More
    http://chubb.co.nz/en/nz/products/commercial-security/intruder-alarm-monitoring/
  58. Chubb Learn More
    http://chubb.co.nz/en/nz/about/history/
  59. Chubb Contact Us
    http://chubb.co.nz/en/nz/contact/
  60. Chubb Get in touch
    http://chubb.co.nz/en/nz/contact/
  61. Chubb Rescue and hazmat
    http://chubb.co.nz/en/nz/products/fire-protection/rescue-products-hazmat/
  62. Chubb Chubb eStore open_in_new
    http://store.chubb.co.nz/
  63. Chubb Business security
    http://chubb.co.nz/en/nz/products/commercial-security/
  64. Chubb Home security open_in_new
    http://security.chubb.co.nz/
  65. Chubb Security alarm monitoring
    http://chubb.co.nz/en/nz/products/commercial-security/intruder-alarm-monitoring/
  66. Chubb Contact Chubb
    http://chubb.co.nz/en/nz/contact/
  67. Chubb Privacy notice
    http://chubb.co.nz/en/nz/legal/privacy-notice/
  68. Chubb Terms of Use
    http://chubb.co.nz/en/nz/legal/terms-of-use/
  69. Chubb Terms and Conditions
    http://chubb.co.nz/en/nz/legal/terms-and-conditions/
  70. Chubb Sitemap
    http://chubb.co.nz/en/nz/sitemap/

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Chubb.co.nz

alarmsecurity alarm monitoringhastrainingchoosesecuritycollapse menualarmshelplearndetection and suppressionpremises protectedhome securityallmonitoringviewmonitoring centresfindsecurity solutionsusproductsourservicesemergencywesearchsearchresponsemonitoredfire detectionproducts and servicesopeninnewbusiness securitymaintenancekeyboardarrowup collapsetodaymoreyouropeninnew keyboardarrowupwebsitefire protectionvitalcallinformationprotected by chubblocationsrangeservices firelearn morecontact us0your worldopeninnew keyboardarrowup collapsevisitmenuprotectionzealandhomeservice and maintenancedetectionyour homecancentresworldsecurity alarmcontactpremiseslocks amp safesnew zealandindustrycontact chubbfireestoreview allamp safeslocks amprequirementspersonalyouinstallationkeyboardarrowup collapse menulocksampkeyboardarrowupchubbprotectedservicechubb estorenewtechnologiessolutionsprotectingyearsalarm monitoringsuppressioncallsystemssafescollapse1200 yearsbusinessplease

Longtail Keyword Density for Chubb.co.nz

KeywordsOccurences
keyboardarrowup collapse menu8
products and services4
detection and suppression3
service and maintenance3
protected by chubb3
openinnew keyboardarrowup collapse3
locks amp safes3
security alarm monitoring3
fire protection10
learn more10
keyboardarrowup collapse8
collapse menu8
new zealand7
alarm monitoring7
security solutions6
chubb estore4
home security4
200 years4
security alarm3
business security3
contact us3
contact chubb3
openinnew keyboardarrowup3
your home3
amp safes3
locks amp3
monitoring centres3
premises protected3
services fire3
view all3
fire detection3
your world3
fire32
security29
chubb25
your16
more12
new12
protection12
monitoring11
solutions11
our11
home10
learn10
products10
menu9
vitalcall8
alarm8
collapse8
keyboardarrowup8
services8
openinnew8
service7
business7
zealand7
safes7
emergency7
all6
contact6
systems6
us6
you6
can6
estore5
maintenance5
industry5
locations4
choose4
has4
years4
04
locks4
help4
call4
world4
response4
information4
premises4
suppression4
visit4
alarms4
technologies3
protecting3
searchsearch3
please3
we3
installation3
today3
detection3
website3
range3
training3
personal3
protected3
find3
requirements3
monitored3
centres3
13
amp3
view3

Who hosts Chubb.co.nz?

Chubb.co.nz Hosting Provider Information

Hosted IP Address:104.18.8.84
Hosted Hostname:104.18.8.84
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "CloudFlare, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%
CloudFlare, Inc.
1.2102%

HTTP Header Analysis for Chubb.co.nz

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Wed, 28 Oct 2020 05:32:54 GMT
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: max-age=3600
Expires: Wed, 28 Oct 2020 06:32:54 GMT
Location: https://www.chubbfiresecurity.com/en/nz/
cf-request-id: 060f4af3c500000052171b0000000001
Vary: Accept-Encoding
Server: cloudflare
CF-RAY: 5e9247660aaa0052-LHR

Chubb.co.nz Domain Nameserver Information

HostIP AddressCountry
tricia.ns.cloudflare.com 173.245.58.232
gabe.ns.cloudflare.com 173.245.59.114


Need to find out who hosts Chubb.co.nz?


Domain Registration (WhoIs) information for Chubb.co.nz

 % Terms of Use
%
% By submitting a WHOIS query you are entering into an agreement with Domain
% Name Commission Ltd on the following terms and conditions, and subject to
% all relevant .nz Policies and procedures as found at https://dnc.org.nz/.
%
% It is prohibited to:
% - Send high volume WHOIS queries with the effect of downloading part of or
% all of the .nz Register or collecting register data or records;
% - Access the .nz Register in bulk through the WHOIS service (ie. where a
% user is able to access WHOIS data other than by sending individual queries
% to the database);
% - Use WHOIS data to allow, enable, or otherwise support mass unsolicited
% commercial advertising, or mass solicitations to registrants or to
% undertake market research via direct mail, electronic mail, SMS, telephone
% or any other medium;
% - Use WHOIS data in contravention of any applicable data and privacy laws,
% including the Unsolicited Electronic Messages Act 2007;
% - Store or compile WHOIS data to build up a secondary register of
% information;
% - Publish historical or non-current versions of WHOIS data; and
% - Publish any WHOIS data in bulk.
%
% Copyright Domain Name Commission Limited (a company wholly-owned by Internet
% New Zealand Incorporated) which may enforce its rights against any person or
% entity that undertakes any prohibited activity without its written
% permission.
%
% The WHOIS service is provided by NZRS Limited.
%
version: 8.0
query_datetime: 2020-09-26T17:10:16+12:00
domain_name: chubb.co.nz
query_status: 200 Active
domain_dateregistered: 1996-12-10T00:00:00+13:00
domain_datelastmodified: 2019-12-22T19:05:31+13:00
domain_datecreated: 1996-12-10T00:00:00+13:00
domain_delegaterequested: yes
domain_signed: no
%
registrar_name: CSC Corporate Domains, Inc
registrar_address1: 251 Little Falls Drive,
registrar_city: Wilmington
registrar_province: Delaware
registrar_postalcode: 19808
registrar_country: US (UNITED STATES)
registrar_phone: +1 302 6365400
registrar_fax: +1 302 636 54500
registrar_email: Login to show email
tricia.ns.cloudflare.com
ns_name_02: gabe.ns.cloudflare.com
%
% Additional information may be available at https://www.dnc.org.nz/whois/search?domain_name=chubb.co.nz
%

Websites with Similar Names

Chubb-group.com
403 Forbidden
Chubb-seguros.com
Chubb in the UK
Chubb.co.nz
Chubb New Zealand | Chubb Fire Safety | Chubb Security | Alarms | Locksmiths
Chubb.co.uk
Chubb is one of the UK’s best known providers of fire safety and security solutions for businesses, organisations and residential properties nationwide.
Chubb.co.za
Index of /
Chubb.com
Chubb in the UK
Chubbable.com
Chubbable - Blogs About Free and Open Source Software
Chubbaccent.com.br
Companhia de seguros | Chubb Accent

Recently Updated Websites

Mirdj.ru 2 seconds ago.Listentotheearth.net 3 seconds ago.Cctvreseller.com 4 seconds ago.Baby-emporium.com 4 seconds ago.Artisansserrurier.com 5 seconds ago.Mikemilesmuaythai.com 7 seconds ago.Flipthescriptmt.com 7 seconds ago.Terriercity.com 10 seconds ago.Brooklynkohl.com 10 seconds ago.Immobil3d.it 10 seconds ago.Mitzphotography.com 11 seconds ago.Yo1wellnesscenter.biz 12 seconds ago.Miseguroporsemanas.net 12 seconds ago.Pixstockphoto.com 13 seconds ago.Gothamdeepsquare.com 13 seconds ago.Faith91.com 14 seconds ago.Loyalwolfhound.club 15 seconds ago.Distribucija.rs 16 seconds ago.3sixtystreet.in 17 seconds ago.Grevlingard.info 17 seconds ago.Fairkumquat.com 17 seconds ago.Ceimm.com 19 seconds ago.Ceimeetings.com 20 seconds ago.Harry-lees.com 20 seconds ago.Carcluboutlet.net 20 seconds ago.Sacredodyssey.org 21 seconds ago.Sinatramusicalbroadway.com 21 seconds ago.Lavaboss.si 22 seconds ago.Cr-emergency.org 22 seconds ago.Blockchainreputationmanagement.com 23 seconds ago.