Cineblog.it  |  Film e cinema: recensioni e trailer dei film da vedere
Low trust score  | 
Blogo




Cineblog.it Website Information

Website Ranks & Scores for Cineblog.it

Statvoo Rank Statvoo Rank:E
Alexa Rank Alexa Rank:55,963
Majestic Rank Majestic Rank:101,804
Domain Authority Domain Authority:42%
DMOZ DMOZ Listing:No

Domain Information for Cineblog.it

Domain Registrar: IT-Nic
Expiration Date:2016-02-22  3 years 3 months 3 weeks ago

Whois information for cineblog.it

Full Whois Lookup for Cineblog.it Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Cineblog.it. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

*********************************************************************
* Please note that the following result could be a subgroup of *
* the data contained in the database. *
* *
* Additional information can be visualized at: *
* http://www.nic.it/cgi-bin/Whois/whois.cgi *
*********************************************************************

Domain: cineblog.it
Status: ok
Created: 2004-10-28 00:00:00
Last Update: 2017-07-25 13:28:06
Expire Date: 2018-01-25

Registrant
Organization: Blogo.it S.r.l.
Address: Via Pordenone 8
Milano
20132
MI
IT
Created: 2017-01-25 00:48:02
Last Update: 2017-01-25 00:48:02

Admin Contact
Name: Esposito Salvatore
Organization: Blogo.it S.r.l.

Technical Contacts
Name: Domains Innoteam
Organization: Innoteam SRL

Registrar
Organization: Gandi SAS
Name: GANDI-REG
Web: http://www.gandi.net

Nameservers
ns-128.awsdns-16.com
ns-1587.awsdns-06.co.uk
ns-1032.awsdns-01.org
ns-1014.awsdns-62.net

Who hosts Cineblog.it?

Cineblog.it is hosted by Level 3 Communications, Inc. in .
Cineblog.it has an IP Address of 80.239.202.59 and a hostname of 80-239-202-59.customer.teliacarrier.com and runs Apache/2.2.22 (Debian) web server.



Cineblog.it Web Server Information

Hosted IP Address:80.239.202.59
Hosted Hostname:80-239-202-59.customer.teliacarrier.com
Service Provider:Level 3 Communications, Inc.
Hosted Country:Not Applicable
Location Latitude:47
Location Longitude:8
Webserver Software:Apache/2.2.22 (Debian)

HTTP Header Analysis for Cineblog.it

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 26 Jun 2015 06:32:40 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 48067
Connection: close
Content-Type: text/html; charset=UTF-8


Need to find out who hosts Cineblog.it?

Cineblog.it Free SEO Report

Website Inpage Analysis for Cineblog.it

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Cineblog.it

oursetsuser statusstorytvcuriosit3tradellafelicitondahungerwalkgatta cenerentolauserofficeindovinachestoria dilocandinadeathseafantasticiprendertabarticlesdeletebellafireoutcenerentolamefalsedal 24 agostocasoanimali fantasticidi tecinema dal 24brothersamericatrailerrobertnienteawardspconsolelogresponseerrormessageguerrabeen loadedneisegretocomefoto esunamericanhotqueenlongarticleurlgattoil filmnostri3dadtuttigirlparticlescurrentpage 0sonoraonefbnuovamichaelheartdelsonodi cartaworldfunctionresponse ifvarvideodeglidal 24responselo hobbitgoodlecterboypconsoleunkingtypeofnovemberfestival di veneziagiornibriannottefelicidaydafoewhiteveritfotoal cinema daldidonnamenfestival 201316risingurltraindel filmloelseimpossibleamicistasera in tvpconsolelogresponseerrormessage elseblogodel torocallbackresponseentertainmentwarstoneifactreginacityoriginsgirlshunger gamespostfugasteelmusicallastprincipeprofelement has beenfilm dimrroma film festivaltorino film festivalresponse xhrif responseaftersudampsignaldanimazionescriptforeverdi veneziadovereturnlamorecannesroma filmdarkboysstarresponsedatablogouserloggedincommunitystaserapgetpermalinkcpfrictionlesssharingenabledstoriagamerebootmonsterallacolonnakideverpopulatedluomoe colonna sonoraneedsolocolonna sonorachistatusbabytegadgetapntaganqpushfunction signaltrueactioncineblognulldatagentedomide colonnaufficialeagosto 20174recensione curiosit etrashragazzanif the usermovie awardsinfernofestival 2012categoriecurrentjohnrenderssoyoumovietoro21 agosto 2017continua staseraobjecttotalpagesmioliketiunounamagicnomainonbloodlittlexsearchnodeclassnamehighsuallematrimoniofestivalreadysenzaangel0 ifil remakenewsprimafunction iftrailer recensione curiositif response responseerrorconsolecittnoistar warsresponsestatusknockcallbackemmatimethree2017 continuagetbrooklyn5pergonefilmzdragon13valpresidentepfbpushingsagacultlehas beendom elementliveactionphandletabarticlespublishpermission7film festival 2013pcurrentuserfbstatusaccesstokenuna storiamarye locandinaowen12terracoopernomefunctiondata21 agostoblackwomanpicturesfamigliaromacommediamortooscardatrailer recensioneberlinosifunctionresponse if responsefunctionresponsebeyondpclickshowarticlespagedsearchnodeclassesmidnightundefinedanimaliallroadstoriegrande15sepapstaxhrbox officetomrecensioneghostcinemaalicelocandina delagostoe ilfuocoresponseerrorscemoapntaganqpushfunctionrealtorino film18gli8loadedildiosaga diyourmamenuseimoglieplogoutviaggioprojectmiastarsmiif typeofsottopfbapikillbattlepermission10iodanielsuldeimyjessicaivan24 agostosignal to scriptfilm festival 2012permalinklimitconcontinuabigdevilpigattasac17flashcommunitysemprehannibal lecterreddueesecretbeennewsreadsresponseerror pconsolelogresponseerrormessageitalianohalloweenjamessisterlunaconnectedrobinnightfilm festivaljack2livecinema daldom element hasamore1westjackson2016 festivalcarta14silenzionataleboxeastviaspecialipconsolelogfbdogelement hasmadagascarharrye locandina delhascuriosit emissionremakecarsparticlescurrentpagegreenlparticlesoffsetquandonuovostoretuttebossskypcurrentuserfbstatus connecteddierecensione curiositdalpconsolelogconnectedcuriosit e colonnadavidtaleal cinemaresponseerror pconsolelogresponseerrormessage elsenessunolovebadhomebusinesslordhas been loadedfunctionvitatorinodownhousecaptain0endbiopicresponse responseerrorhanniballocarnoreturn falselultimomancult de sacfestival diwilsonelementtuttodelle9warshotelveneziasequel11il silenziofoto e locandinaarticles6junglehobbitblogoitgameslifelocandina del filmbillfilm danimazionetitle

Longtail Keyword Density for Cineblog.it

KeywordsOccurences
roma film festival7
signal to script6
has been loaded6
dom element has6
element has been6
stasera in tv5
torino film festival5
festival di venezia5
if response responseerror4
locandina del film4
functionresponse if response4
film festival 20124
e locandina del4
recensione curiosit e4
foto e locandina4
al cinema dal4
21 agosto 20174
curiosit e colonna4
e colonna sonora4
trailer recensione curiosit4
responseerror pconsolelogresponseerrormessage else3
if the user3
dal 24 agosto3
cult de sac3
film festival 20133
cinema dal 243
film festival18
il film11
agosto 20178
film di8
roma film7
dom element6
element has6
apntaganqpushfunction signal6
has been6
if typeof6
been loaded6
di venezia5
festival di5
e locandina5
al cinema5
curiosit e5
functionresponse if5
lo hobbit5
torino film5
box office4
pconsolelogresponseerrormessage else4
e il4
star wars4
response responseerror4
pcurrentuserfbstatus connected4
animali fantastici4
if response4
festival 20124
colonna sonora4
continua stasera4
trailer recensione4
e colonna4
21 agosto4
gatta cenerentola4
cinema dal4
foto e4
recensione curiosit4
locandina del4
del film4
function if3
dal 243
response xhr3
24 agosto3
film danimazione3
il silenzio3
del toro3
0 if3
return false3
hannibal lecter3
responseerror pconsolelogresponseerrormessage3
particlescurrentpage 03
user status3
2016 festival3
il remake3
saga di3
una storia3
movie awards3
storia di3
hunger games3
2017 continua3
festival 20133
di carta3
di te3
di115
film104
il103
e70
065
if47
remake37
var34
del32
125
un25
festival25
una23
della19
218
function18
318
non18
che17
per16
trailer14
al14
me14
dei14
cinema14
return13
le13
con12
tv11
fb11
natale11
star10
venezia10
else10
vita10
lo10
gli10
continua10
cineblog9
man9
data9
agosto9
true9
boy9
storia9
black9
amp9
queen9
48
delle8
oscar8
cannes8
life8
you8
blogo8
58
war8
mr8
bad8
roma8
degli8
ad8
kill8
noi8
reboot8
response8
68
78
loaded8
good7
due7
87
animali7
user7
movie7
97
connected7
url7
chi7
senza7
ready7
prendertabarticles7
responseerror7
little7
blood7
da7
false7
script7
dal7
dark7
sea7
106
american6
116
girl6
come6
ragazza6
grande6
story6
locandina6
prima6
accesstoken6
pi6
community6
awards6
undefined6
stasera6
status6
particles6
typeof6
functionresponse6
office6
dom6
signal6
apntaganqpushfunction6
home6
element6
has6
box6
populated6
been6
su6
particlescurrentpage6
te6
mia6
curiosit6
love6
sei5
world5
live-action5
solo5
3d5
io5
limit5
hobbit5
id5
offset5
gente5
regina5
all5
callback5
xhr5
torino5
musical5
viaggio5
captain5
n5
pcurrentuserfbstatus5
ti5
wars5
si5
red5
big5
game5
125
ma5
night5
sul5
tom5
uno5
david5
sotto5
cenerentola5
green5
foto5
action5
giorni5
dove5
king5
james5
entertainment5
house4
134
tutti4
men4
after4
down4
principe4
144
road4
gatta4
console4
lultimo4
last4
tra4
robert4
out4
indovina4
pfrictionlesssharingenabled4
l4
citt4
niente4
end4
harry4
day4
daniel4
jack4
current4
recensione4
notte4
origins4
hotel4
pictures4
locarno4
nuovo4
high4
biopic4
nome4
se4
sonora4
colonna4
fantastici4
november4
your4
trash4
no4
pconsolelogfb4
three4
baby4
dragon4
sun4
sister4
pfbapi4
154
newsreads4
mi4
responsedata4
pconsolelogresponseerrormessage4
terra4
one4
so4
emma4
saga4
mai4
walk4
stone4
my4
fire4
cult4
berlino4
speciali4
halloween4
live4
danimazione3
woman3
steel3
storie3
magic3
wilson3
scemo3
permission3
project3
delete3
nessuno3
donna3
c3
amore3
quando3
sempre3
mission3
need3
midnight3
impossible3
onda3
v3
pclickshowarticlespaged3
matrimonio3
cars3
functiondata3
totalpages3
morto3
renders3
phandletabarticles3
blogouserloggedincommunity3
ufficiale3
pconsolelogconnected3
mary3
menu3
post3
video3
callbackresponse3
gadget3
articleurl3
searchnodeclasses3
searchnodeclassname3
sets3
plogout3
news3
responsestatus3
permalink3
blogoit3
alle3
object3
italiano3
commedia3
west3
white3
owen3
via3
articles3
publishpermission3
nostri3
tutte3
pgetpermalink3
pconsole3
title3
null3
pfbpushing3
verit3
secret3
brian3
ever3
store3
robin3
michael3
dafoe3
business3
segreto3
brothers3
boss3
brooklyn3
lord3
sono3
jessica3
die3
163
dog3
death3
inferno3
carta3
z3
our3
john3
long3
hot3
angel3
tale3
america3
stars3
battle3
bella3
time3
act3
alice3
forever3
amici3
felici3
pap3
presidente3
beyond3
sac3
sequel3
kid3
prof3
rising3
173
boys3
monster3
knock3
city3
ivan3
nei3
felicit3
dio3
jackson3
categorie3
real3
cooper3
sud3
lecter3
hannibal3
sta3
luna3
183
moglie3
silenzio3
luomo3
jungle3
alla3
lamore3
nuova3
mio3
gatto3
x3
get3
ghost3
train3
fuga3
flash3
guerra3
east3
sky3
famiglia3
like3
gone3
toro3
fuoco3
madagascar3
caso3
games3
hunger3
bill3
heart3
devil3
girls3
tutto3

What are the nameservers for cineblog.it?

Cineblog.it Domain Nameserver Information

HostIP AddressCountry
ns1.eurodns.com 204.74.66.130United States United States
ns2.eurodns.com 204.74.110.130United States United States
ns3.eurodns.com 204.74.67.130United States United States
ns4.eurodns.com 204.74.111.130United States United States

Cineblog.it Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Cineblog.it is a scam?