CIO.com - Tech News, Analysis, Blogs, Video

Safety: Low trust score
Year Founded: 2005
Global Traffic Rank: 441,339
Estimated Worth: $9,720

CIO.com delivers the latest tech news, analysis, how-to, blogs, and video for IT professionals. Covers apps, careers, cloud computing, data center, mobile, outsourcing, security, social media, hardware and software.



Domain summary

Last updated
2021-04-16
Domain label
cio
Domain extension
in
Domain registered:
2005-02-16
Domain updated:
2021-04-16
Global Traffic Rank
441,339
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$9,720
Estimated daily income
$27
Estimated monthly income
$821

Rank summary

How is cio.in ranked relative to other sites:

Percentage of visits to cio.in from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Cio.in registered?
A: Cio.in was registered 16 years, 2 months, 2 days, 11 hours, 8 minutes, 51 seconds ago on Wednesday, February 16, 2005.
Q: When was the WHOIS for Cio.in last updated?
A: The WHOIS entry was last updated 2 days, 11 hours, 8 minutes, 51 seconds ago on Friday, April 16, 2021.
Q: What are Cio.in's nameservers?
A: DNS for Cio.in is provided by the following nameservers:
  • ns5.markmonitor.com
  • ns1.markmonitor.com
  • ns2.markmonitor.com
  • ns4.markmonitor.com
  • ns3.markmonitor.com
  • ns6.markmonitor.com
  • ns7.markmonitor.com
Q: Who is the registrar for the Cio.in domain?
A: The domain has been registered at INRegistry.
Q: What is the traffic rank for Cio.in?
A: Cio.in ranks 441,339 globally on Alexa. Cio.in has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Cio.in each day?
A: Cio.in receives approximately 2,988 visitors and 8,964 page impressions per day.
Q: What IP address does Cio.in resolve to?
A: Cio.in resolves to the IPv4 address 151.101.2.165.
Q: In what country are Cio.in servers located in?
A: Cio.in has servers located in the United States.
Q: What webserver software does Cio.in use?
A: Cio.in is powered by Apache-Coyote/1.1 webserver.
Q: Who hosts Cio.in?
A: Cio.in is hosted by Consortium GARR in United States.
Q: How much is Cio.in worth?
A: Cio.in has an estimated worth of $9,720. An average daily income of approximately $27, which is roughly $821 per month.

Cio.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Cio.in Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Cio.in

H1 Headings

1 :
  1. cio

H2 Headings

0 :

H3 Headings

18 :
  1. 7 business skills every IT leader needs to succeed
  2. How Sutherland virtualized its clean-desk policy
  3. API management: What CIOs should know
  4. Why steering committees fail to engage (and 5 ways to hold them accountable)
  5. 13 most difficult-to-fill IT jobs
  6. VMware, Dell split to form independent firms
  7. Project management methodologies: How to choose the best for success
  8. 7 business skills every IT leader needs to succeed
  9. 5 perspectives on modern data analytics
  10. Analytics in the cloud: Key challenges and how to overcome them
  11. How Sutherland virtualized its clean-desk policy
  12. API management: What CIOs should know
  13. The biggest enterprise technology M&A deals of 2021
  14. 6 reasons to invest in enterprise architecture tools
  15. How AI is revolutionizing training
  16. CIOs battle product management pitfalls
  17. Rethinking data management for faster time to value
  18. CIOs cash in on COVID heroics

H4 Headings

15 :
  1. There are some common reasons why a transformation steering committee may fail to engage—from a lack of motivation to a bias toward inaction, Here's how transformation leaders can overcome those blockers.
  2. The 2021 State of the CIO survey reveals organizations struggling to fill cybersecurity, AI, and data analytics roles in a year that finds companies looking farther afield to find IT talent.
  3. VMware and Dell say separating gives both companies financial flexibility but lets them continue to grow their technology-development partnership.
  4. Selecting the best project management methodology (PMM) for the job relies on developing a sound evaluation process. Our guide to evaluating PMMs will ensure you pick the perfect fit for your next project.
  5. Today’s CIO needs more than technology mastery. Long-term career success also demands a commitment to developing a set of core business skills.
  6. You can't navigate business challenges without the right instruments. Done right, analytics initiatives deliver the essential insights you need, as these five articles explore.
  7. Moving analytics to the cloud requires new approaches, skills, and architectures compared with analysis done in-house the traditional way.
  8. The business process outsourcing company developed a robust security solution using AI, cloud, RPA, and other security technologies to monitor the activities of staff as they deal with sensitive client information.
  9. APIs hold promise to enhance digital transformations and establish new lines of revenue. From what you spend to how it’s used, programmatic access to data and services is becoming a critical concern.
  10. The first three months of 2021 saw three billion-dollar-plus acquisitions in hardware, software, and services, and plenty of other merger activity in professional services.
  11. EA software can bring order to the innerworkings of your enterprise’s sprawling technical operations. Here is the upside of mapping and cataloging — and some cautions about where the real magic resides.
  12. Pressed by the need to fill skills gaps, organizations are turning to artificial intelligence to transform stagnant training approaches into continually evolving upskilling strategies.
  13. Product management is increasingly the preferred method of delivering digital capabilities. Yet the transition from a project-based mindset is rife with challenges, say IT leaders and experts.
  14. Enterprises should abandon traditional ETL approaches and strategies and adopt future state architectures that distribute the data transformation burden.
  15. IT leaders’ pandemic response has increased their visibility and importance, making them more marketable in landing new gigs, promotions, and greater stakes.

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

76 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-300704-2

Links - Internal

93:

Links - Internal (nofollow)

0:

Links - Outbound

48:

Keyword Cloud for Cio.in

nullup1115 scripttags idggptlogcreatinglearn morescreenlatesteditionpicker5true addslugcode htmlepreventdefaultciosutherlandsherestatesnewsletterpromotypeofciosonly screenvirtualized its cleandeskloadedsetout signits cleandesk policyrightnonewindowdatalayerplacementbodyanimate scrolltophascios should knowplacement nav mega8get napitilenav megafunctiondata statuscrawlitem newsletterpromomegasubmenuskillsfunctionif haseditionsanimateslideleftmenuwidthdirectionendcountrycodeleadergeotwitterurlrelatedtoplatest insiderxhrhaseditions trueenterpriseaddslugcode html varif typeofservicestop1115 scripttagsnew from idgourmanagementbusinessstatus xhrloadhomepagecrawl crawlitem newsletterpromoidggetlocaletrue addslugcodeitsnapitiledocumentreadyfunction varmenuwidth megamenuinnerwidthshould knowdebugcolumnmanagement what ciosaddslugcodesignvar contentcopymenuwidthmenuwidth megamenuinnerwidth animateslideleftmenuwidthhaseditionsyouunited statesmedia onlybusiness skills everymega columnclosetouchinsiderprojectleadersnotleftneeds to succeednav mega columnmegamenuinnerwidth animateslideleftmenuwidth7 business skillsgetlocale placementmobileeveryunitedscripttags idggptlogcreating addataapimegamenuinnerwidthcancontentcopysutherland virtualized itstrainingthemplacement navapproachescleandeskvirtualized its1engagecleandesk policyblox4dynamicelselocalesutherland virtualizedif editionpickerchallengesheighttechnologyyourfalseholdvargeo getlocale placementthmdevicewidthlessthanthmdevicebreakpointstablethtml bodyanimate scrolltopifthmdevicewidthatleastthmdevicebreakpointstabletmore6scripttagsscrolltopadvertisementcrawlitem7functiondatalearncloudlinksbodyanimate scrolltop 0its cleandeskblox4dynamic geo getlocaleproject managementscripttags idggptlogcreatingvaluesign in registerusehaseditions true addslugcodedebuggerreturnhtmlmedia only screenhomepagecrawl crawlitemfailanalyticsinsiderpopupmodalboxlinkedinurl2networkidggptlogcreatinglocaledescbestdef blox4dynamic geosign outhomepagecrawlshouldapi managementsucceedvirtualized3widthmegamenuinner4epreventdefault varresearchinfographicsponsoredsponsoredeventmediaundefinedaddocumentreadyfunctionnavgetlocale placement navmegasteeringbusiness skillsonlybodyanimatedef blox4dynamicgeo getlocalepolicy0pxidggptlogcreating ad7 business9epreventdefault var contentcopyhtml varminwidthdefknownewneedssuccessif thmdevicewidthlessthanthmdevicebreakpointstabletevery it leaderif haseditions trueregisterscrolltop 0whysign out signdigitaltruehtml bodyanimateotherleader needsstatusgetif971 1115ocheadtoplocaleidtransformationdefaultblox4dynamic geofacebookurladdslugcode htmlfunctiondata status xhr0aicios shouldskills everyoutbanneruscookiereasonsglobalborderscreen and minwidth

Longtail Keyword Density for Cio.in

KeywordsOccurences
scripttags idggptlogcreating ad6
1115 scripttags idggptlogcreating6
def blox4dynamic geo5
blox4dynamic geo getlocale5
functiondata status xhr5
getlocale placement nav4
menuwidth megamenu-innerwidth animateslideleftmenuwidth4
true addslugcode html4
haseditions true addslugcode4
nav mega column4
placement nav mega4
if haseditions true4
geo getlocale placement4
every it leader4
7 business skills4
business skills every4
homepage-crawl crawl-item newsletter-promo4
needs to succeed4
sign out sign3
addslugcode html var3
sutherland virtualized its3
virtualized its clean-desk3
new from idg3
management what cios3
cios should know3
media only screen3
screen and min-width3
html bodyanimate scrolltop3
bodyanimate scrolltop 03
epreventdefault var contentcopy3
sign in register3
its clean-desk policy3
1115 scripttags6
971 11156
scripttags idggptlogcreating6
idggptlogcreating ad6
functiondata status5
business skills5
if typeof5
menuwidth megamenu-innerwidth5
haseditions true5
get napitile5
placement nav5
geo getlocale5
blox4dynamic geo5
def blox4dynamic5
status xhr5
nav mega4
homepage-crawl crawl-item4
megamenu-innerwidth animateslideleftmenuwidth4
epreventdefault var4
addslugcode html4
true addslugcode4
if haseditions4
mega column4
getlocale placement4
skills every4
learn more4
7 business4
leader needs4
crawl-item newsletter-promo4
html var3
bodyanimate scrolltop3
documentreadyfunction var3
if edition-picker3
united states3
var contentcopy3
latest insider3
project management3
if thmdevicewidthlessthanthmdevicebreakpointstablet3
scrolltop 03
html bodyanimate3
sutherland virtualized3
sign out3
media only3
out sign3
should know3
cios should3
api management3
clean-desk policy3
its clean-desk3
virtualized its3
only screen3
if45
var41
homepage-crawl29
true18
018
ad16
html13
function13
112
else12
edition-picker11
new10
epreventdefault10
documentreadyfunction9
false9
idg9
get9
management9
more8
business8
null8
linkedinurl8
ocheadtop8
getlocale8
facebookurl7
insider7
status7
sign7
policy7
twitterurl7
skills7
cio7
26
idggptlogcreating6
left6
functiondata6
scripttags6
not6
us6
cios6
scrolltop6
placement6
menuwidth6
haseditions6
typeof5
megamenu-inner5
blox4dynamic5
them5
analytics5
ifthmdevicewidthatleastthmdevicebreakpointstablet5
should5
data5
mega5
you5
mega-submenu5
35
45
cookie5
def5
geo5
undefined5
its5
insider-popupmodal-box5
your5
needs5
megamenu-innerwidth5
countrycode5
55
xhr5
nav5
napitile5
64
advertisement4
top4
height4
use4
only4
animateslideleftmenuwidth4
locale4
loaded4
localedesc4
windowdatalayer4
localeid4
sponsored4
united4
direction4
load4
74
width4
none4
best4
every4
leader4
succeed4
project4
out4
crawl-item4
learn4
newsletter-promo4
s4
column4
addslugcode4
set4
ai4
transformation4
success4
digital4
technology4
links4
contentcopy3
researchinfographicsponsored3
mobile3
thmdevicewidthlessthanthmdevicebreakpointstablet3
our3
cloud3
end3
approaches3
services3
leaders3
banner3
can3
touch3
challenges3
close3
default3
83
api3
clean-desk3
virtualized3
sutherland3
93
register3
hold3
reasons3
engage3
fail3
steering3
why3
latest3
here3
states3
know3
enterprise3
global3
return3
has3
event3
debugger3
relatedtop3
bodyanimate3
up3
other3
value3
training3
min-width3
screen3
media3
right3
border3
0px3
network3
debug3

Who hosts Cio.in?

Cio.in Hosting Provider Information

Hosted IP Address:151.101.2.165
Hosted Hostname:151.101.2.165
Service Provider:Consortium GARR
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Apache-Coyote/1.1

Is "Consortium GARR" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%
Consortium GARR
0.1218%

HTTP Header Analysis for Cio.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: keep-alive
Content-Length: 34414
Server: Apache-Coyote/1.1
Content-Type: text/html;charset=UTF-8
Content-Encoding: gzip
Cache-Control: max-age=14400
X-fastly-ttl: 14400.000
X-fastly-stale: 432000.000
Accept-Ranges: bytes
Via: 1.1 varnish, 1.1 varnish
Age: 3160
Date: Fri, 16 Apr 2021 03:50:54 GMT
X-Served-By: cache-sjc10071-SJC, cache-lon4271-LON
X-Cache: HIT, MISS
X-Cache-Hits: 6, 0
X-Timer: S1618545054.075714,VS0,VE134
X-Via-Fastly: Verdad
Vary: Accept-Encoding,Cookie
x-vcl-version: 300

Cio.in Domain Nameserver Information

HostIP AddressCountry
ns5.markmonitor.com 192.174.68.3
ns1.markmonitor.com 64.124.69.50
ns2.markmonitor.com 176.97.158.1
ns4.markmonitor.com 176.97.158.2
ns3.markmonitor.com 192.174.68.2
ns6.markmonitor.com 176.97.158.3
ns7.markmonitor.com 192.174.68.4


Need to find out who hosts Cio.in?


Domain Registration (WhoIs) information for Cio.in

 Domain Name: cio.in
Registry Domain ID: D527200-IN
Registrar WHOIS Server:
Registrar URL: http://www.markmonitor.com
Updated Date: 2021-01-20T10:04:17Z
Creation Date: 2005-02-16T07:15:05Z
Registry Expiry Date: 2022-02-16T07:15:05Z
Registrar: MarkMonitor Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Registry Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: International Data Group, Inc.
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: MA
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: US
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR PRIVACY
Registrant Email: Please contact the Registrar listed above
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email: Please contact the Registrar listed above
Registry Tech ID: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR PRIVACY
Tech Email: Please contact the Registrar listed above
Name Server: ns5.markmonitor.com
Name Server: ns1.markmonitor.com
Name Server: ns2.markmonitor.com
Name Server: ns4.markmonitor.com
Name Server: ns3.markmonitor.com
Name Server: ns6.markmonitor.com
Name Server: ns7.markmonitor.com
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-04-16T03:50:54Z

Websites with Similar Names

Cio-aaservice.com
MKB IT Businesspartner-Home
Cio-asia.com
CIO.com - Tech News, Analysis, Blogs, Video
Cio-benelux.com
Events List Page | NOORD-GROUP LTD
Cio-channel.ch
IT-Praxis für KMU
Cio-chime.org
College of Healthcare Information Management Executives - CHIME

Recently Updated Websites

Osteovox.com (1 second ago.)Barcartchic.com (1 second ago.)Simpleshoes.com (1 second ago.)Florida-interaktiver.com (1 second ago.)Boxingtreasures.com (2 seconds ago.)Cretemediaonline.com (2 seconds ago.)Rebounze.com (2 seconds ago.)Ttvhqs.xyz (2 seconds ago.)Sakarsharma.blogspot.com (2 seconds ago.)Upgal.com (2 seconds ago.)Nautalis.tv (2 seconds ago.)Pcs-jp.com (3 seconds ago.)Sstlg.biz (3 seconds ago.)Alphabeta.agency (3 seconds ago.)Mittforpresident2020.info (3 seconds ago.)Thenomadsjourney.com (3 seconds ago.)Carsontranquille.com (3 seconds ago.)Petronilawestateplanningwebinar.com (3 seconds ago.)Ocaetnic.com (4 seconds ago.)Stubergacres.info (4 seconds ago.)Kurrlefuels.com (4 seconds ago.)Clarksburgrotary.com (4 seconds ago.)Houstonmicroneedling.com (4 seconds ago.)Jfax.com (4 seconds ago.)Asimomy.com (5 seconds ago.)Gvdivadance.com (5 seconds ago.)Jayrecommends.com (5 seconds ago.)Hbshunte.com (5 seconds ago.)Kinhtvu.com (5 seconds ago.)Stonehavenrealty.com (5 seconds ago.)

Recently Searched Keywords

-22px border-width 0px (1 second ago.)entire home (1 second ago.)button in arabic (2 seconds ago.)andrzeja (2 seconds ago.)3 pc cd (3 seconds ago.)fished (6 seconds ago.)camp jobs (7 seconds ago.)1 items (8 seconds ago.)view our customers (10 seconds ago.)учителя (11 seconds ago.)wta (12 seconds ago.)people have (12 seconds ago.)snx (13 seconds ago.)spare driver for hire (15 seconds ago.)mehr als (16 seconds ago.)baidu 云计算平台 (17 seconds ago.)macaron (18 seconds ago.)三亚天气 (21 seconds ago.)为什么要开放材料?——专访raise3d材料负责人金珉德博士 (21 seconds ago.)centurion meaning (21 seconds ago.)记录 (25 seconds ago.)scrollbar-width none (27 seconds ago.)tanzen rauchen (28 seconds ago.)keydown if (28 seconds ago.)kamprets (29 seconds ago.)importantline-height 26px (30 seconds ago.)cnc mill (30 seconds ago.)gross domestic (30 seconds ago.)siding  (31 seconds ago.)iqos (32 seconds ago.)