|  Clean Code Developer | Eine Initiative für mehr Professionalität in der Softwareentwicklung
Low trust score  | Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:2,324,224
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:45%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
% Restricted rights.
% Terms and Conditions of Use
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:

Status: connect
Changed: 2008-11-19T12:41:23+01:00

Type: ROLE
Name: HostEurope GmbH
Address: Hansestrasse 111
PostalCode: 51149
City: Köln
CountryCode: DE
Phone: +49 800 4678387
Fax: +49 1805 663233
Email: Login to show email

Type: ROLE
Name: HostEurope GmbH
Address: Hansestrasse 111
PostalCode: 51149
City: Köln
CountryCode: DE
Phone: +49 800 4678387
Fax: +49 1805 663233
Email: Login to show email

Who hosts is hosted by domainfactory GmbH in North Rhine-westphalia, Hoest, Germany, 47652. has an IP Address of and a hostname of and runs Apache/2.4.10 web server. Web Server Information

Hosted IP Address:
Service Provider:domainfactory GmbH
Hosted Country:GermanyDE
Location Latitude:51.65
Location Longitude:6.1833
Webserver Software:Apache/2.4.10

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 15 Dec 2015 03:32:44 GMT
Server: Apache/2.4.10
X-Powered-By: PHP/5.2.17
Link:; rel=shortlink
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

dasswenneseinescleanderwir meinenerumein professioneller0dasein professioneller softwareentwicklersoftwareentwicklernichtsieeinemprofessionellerder softwareentwicklungseinemithabenschonwrdeprofessioneller softwareentwicklerbuchdemsoeinfachcodeclean codekeininitiativeuntereingemeinsamennochmeineneinehates istauchcode developersichsindalswir essoftwareentwicklungnurabervonzufriedendiewertesystemfr mehristoderfrprofessionalitt in dertunmehr professionalitteinenmehrwiretwasdesein buchseinclean code developerprofessionalittmalcode alsgradnichtsglaubendeveloperzugeld

Longtail Keyword Density for

clean code developer5
professionalitt in der4
ein professioneller softwareentwickler3
clean code10
code developer5
der softwareentwicklung5
code als4
ein buch3
es ist3
wir es3
wir meinen3
fr mehr3
mehr professionalitt3
ein professioneller3
professioneller softwareentwickler3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Germany Germany Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?