КЛИНИНГРАД | Клининг и выездная химчистка

Safety: Low trust score
Year Founded: 2019
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-11-28
Category: This site has not been categorized yet


Domain summary

Domain label
cleanin-grad
Domain extension
ru
Domain registered:
2019-09-04
Domain updated:
2020-11-28
Domain expires:
2021-09-04
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is cleanin-grad.ru ranked relative to other sites:

Percentage of visits to cleanin-grad.ru from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Cleanin-grad.ru registered?
A: Cleanin-grad.ru was registered 1 year, 4 months, 2 weeks, 3 days, 2 hours, 6 minutes, 23 seconds ago on Wednesday, September 4, 2019.
Q: When was the WHOIS for Cleanin-grad.ru last updated?
A: The WHOIS entry was last updated 1 month, 3 weeks, 2 days, 2 hours, 6 minutes, 23 seconds ago on Saturday, November 28, 2020.
Q: What are Cleanin-grad.ru's nameservers?
A: DNS for Cleanin-grad.ru is provided by the following nameservers:
  • ns1.platformalp.ru
  • ns2.platformalp.ru
Q: Who is the registrar for the Cleanin-grad.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Cleanin-grad.ru?
A: Cleanin-grad.ru has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Cleanin-grad.ru each day?
A: Cleanin-grad.ru receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Cleanin-grad.ru resolve to?
A: Cleanin-grad.ru resolves to the IPv4 address 85.119.149.99.
Q: In what country are Cleanin-grad.ru servers located in?
A: Cleanin-grad.ru has servers located in the Russia.
Q: What webserver software does Cleanin-grad.ru use?
A: Cleanin-grad.ru is powered by Openresty webserver.
Q: Who hosts Cleanin-grad.ru?
A: Cleanin-grad.ru is hosted by Academinform JSC in Russia.
Q: How much is Cleanin-grad.ru worth?
A: Cleanin-grad.ru has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Cleanin-grad.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Cleanin-grad.ru Free SEO Report

Website Inpage Analysis for Cleanin-grad.ru

H1 Headings

1 :
  1. Уборка квартир, домов и офисов от 1990 р.

H2 Headings

6 :
  1. Наши услуги и цены
  2. Сделайте расчет стоимости уборки
  3. Почему мы лучшие в сфере клининга
  4. Примеры наших работ
  5. Отзывы наших клиентов
  6. Не хватает времени на уборку?Нет сил на поддержание чистоты?

H3 Headings

10 :
  1. Стоимость частной домработницы с гарантиями компании
  2. Экспресс уборка от 60 р./кв.м.
  3. Генеральная уборка от 80 р./кв.м.
  4. Послестроительная уборка от 90 р./кв.м.
  5. Уборка офисов (цена договорная от 30 р./кв.м.)
  6. Химчистка мягкой мебели от 500 р.
  7. Мытье окон и балконов от 300 р.
  8. Ответьте на 4 простых вопроса и получите точный расчет стоимости услуг клининга и скидку 10% на первый заказ!
  9. Хотите заказать уборку или очистить пятна с мягкой мебели?
  10. Закажите уборку помещения или услугу выездной химчистки мебели и получите в подарок скидку 10% на первую уборку

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

31 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-149341356-1

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Cleanin-grad.ru

wrapper1 backgroundcoloroverflow hidden positionnode99node310px rgba115 163items display flexpaddingright 15pximportantpointer1170pxborderbottomwidth 1px25px node119paddingtop 30px paddingrightplpfieldcheckboxvisual label positionfff borderradius 6pxlineheightall borderradius 2pxitems100px opacity 0backgroundcolor rgb245selementsgridcellcell2 width 100important21plpfieldhiddennode691 node148metaflexgridalignsides display flextextdecoration none borderbottomwidthbackgroundcolor rgb22left textalign centeropen textalignrgba22selementsgridcellcell1 selementsgridcellwrapper paddingtopbreakwordflexgridalignsides display80 textalign centerplpfieldcheckboxlist input255 255boxshadowrepeat colorbgimage tick node148meta25 25padding height 20pxtick node144meta15px 17pxcenter flexgrow 1margintop 10pxname marginbottom0 0 0150px paddingleft 5pxnode119 selementsgridcellcell0node148meta plpfieldradiolist5pxbordertoprightradius 5pxborderbottomrightradius 5pxborderbottomleftradiusposition absolute topmaxwidthplpfieldradiolist span verticalalignwrapper2 paddingtop 36pxborderresizebreakword texttransform uppercase75 display inlineblockplpfieldprivacytext a textdecorationverticalalign middle margintopopacity 0 node145meta79 129colorplpfieldradiovisual inputhover bgimageplpfieldradiolist span0 025 position39pxselementsgridcellwrapper paddingtoptick opacity 0525pximportant paddingrightwidth 0 height90 223 backgroundcolorrgb41 124inlineblock verticalalignplpscreen md elsescreensm node119inputactive241 0750 height 0center borderradius 50pxrgb38 112 181bordercolor0pxborderbottomleftradius 0pxborderstylenode78plpfieldcheckboxvisual ticktextalign center node148meta075node86opacity 0 cursorpaddingleft 0repeatinputhover bgimage tickplpfieldradiovisual inputwidth 0blackabsolute left 5010pximportant paddingbottom 10pximportantpaddingopacity 08 marginbottom0important paddingright108 230name10svgnode145meta plpfieldradiolistpaddingright 0pximportant screenxs35 056025 position relative5px marginbottom 5pxpath fillrgb225 25paddingright 0important screensmfontweight normal displaymarginbottom 65pxnode114rectfillnone fillmiddle lineheight 105px padding 12px5pxborderbottomrightradius 5pxborderbottomleftradius 5pxborderstyleboxshadow none positiontranslate50 505px marginbottompaddingleft 25pxplpfieldprivacycheckbox a verticalaligncursor pointer node144meta11node130 wrapper1 wrapper20px 15pxright fontsizeplpfieldresult flexgridalignright leftnode119 selementsgridcellcell0 widthbordercolor rgb22middle paddingleft 50 cursor pointercursor0pxborderstyle solidbordertopwidth 0pxborderbottomwidthinputactive radio20pximportant paddingleft 0important0 opacity 0plpfieldprivacycheckbox spanwidth 33333333333333336 paddingleftrgba0 0plpfieldresult flexgridselementsgridcellcell1 width 50paddingright 25pximportant screenxspaddingtop 20pxelse if plpscreensnode156selementsgridcellcell415px paddingright768 documentbodyclientwidthpaddingright 15pximportant screenxsnorepeatpaddingleft 0pximportantbreakword textalign rightpaddingright 0pximportantcenter opacity 05plpfieldprivacybutton openfontsize 13px wordwrap35pxfa fontsize10pximportant paddingbottom0bordertopleftradiuspaddingbottom 5px paddingleftnode465px rgba0 0056 paddingtop 37px0 minheightbackgroundcolor rgb34color inherit cursorinlineblock backgroundposition center25pximportant paddingleft 25pximportantnode145meta inputchecked255 255boxshadow insetall borderradius 100pxnode118node77node5425 wordwrap breakword6pxpadding heightfontsize 23pxmarginbottom 5pxpaddingtop 25 verticalalignminwidth 50 wordwrapopacity 1bgimage tick node144metapaddingtop 10pximportant025 positionabsolute top 0color rgba0selementsgridcellcell3plpfieldcheckboxvisualselementsgridcellwrapper paddingtop 20pximportantrgb38flexgridalignright3965px fontsize 13pxnode92padding 12px20px heightcheckbox boxshadowwrapper1 color 333paddingtop 25selementsgridcellcell3 widthrgb22 102 241selementsgridcellcell3 selementsgridcellwrapper paddingtopalignitemsdefs pathrgb36faradiobefore opacity 1plpfield paddingbottom1 node148meta plpfieldfiletransformselementsgridcellcell3 selementsgridcellwrappernode5210px paddingbottom 5px15pximportant screensm0bordercolor rgb32 66plpfieldprivacycheckboxrgb37 112display inlineblocksolid rgba0 05px padding15pximportant paddingleftmarginleftinset145colormiddle margintopnowrap223 backgroundcolortextalign leftcolor 333solidbordertopwidth 0pxborderbottomwidth 0pxborderleftwidthplpfieldcheckboxvisual inputfocus14px fontfamilyrgba1036pxscale0 transitionplpfieldradiovisual bgimage backgroundsizepaddingtop 0px paddingrightpointer position7px50 topnode143rgb30letterspacing 01emrgb242breakword whitespace normalborderwidthselementsgridcellcell0 selementsgridcellwrapper paddingtop112 181bordercolor rgb27openwidth 50 paddingleftrgb33 99opacity 0 transitionborderradius 8pxwhitespace normal28rgb41 182verticalalign middle screenxsnode142plpfieldresult flexgridalignsides leftplpfieldresult flexgrid rightscreenxs node148meta12px 96pxwrapper1 wrapper2 backgroundcolortranslate50bordercolor rgb138 179255 color 333paddingtop 37px paddingrightinputchecked radiobefore opacitynode119inputactive checkbox boxshadow175px paddingleftboxshadow inset 0inputfocus checkbox bordercolornode1291px borderbottomstyle181bordercolor rgb27241 075 transition05 border161paddingtop83 145left 5025px paddingleftrgba45 92 161node9rgb41textalign centermargin 7px 090 223backgroundsize cover102 241 backgroundcolor22px padding 0970pxcolor rgb25 108flexgridalignleftsolidnode20textdecorationpadding 12px 96pxradiobeforenode138paddingbottom 17pxmarginrightcenter flexgrow0important screenxs node75screenxs node75selementsgridcellwrapperplpfieldfile flexgridplpfieldresult flexgridaligncenter rightcursor pointer positionrgb27 80 129colorselementsgridcellcell5middle margintop 5pxrgb42overflow hidden30px paddingleft100 textalign leftmarginnode4237300ms opacity 0node4726px245 245plpfieldprivacytext20px20pximportant paddingleft0pxbordercolornode130 wrapper117px 0px rgba115rgba41 83 145verticalalign middle node144metargb34 100 161paddingtopplpfieldradiovisual labeltop 0 leftplpfieldcheckboxinput inputnode30borderstylefontsize 80middle paddingleft10px whitespaceplpfieldprivacycheckbox input position0pxborderbottomrightradius 0pxborderbottomleftradiusinputchecked radiocontainercover display inlineblockpaddingtop 0pximportantpaddingleft 5 marginleftscreenxs node145meta plpfieldradiovisualnode75 selementsgridcellcell3163bordercolornode119 selementsgridcellcell1 width0 05 border0 opacity100important paddingleft 0pximportantflexgridalignleft rightrgb225 25 230opacity14px cursorflexgridaligncenter right0px paddingright 0pointer position relative247 0130 opacity 05tick0 node148metacheckboxbackgroundsizergb34 100rgb38 1120560 transitionitemlabel fontweightselementsgridcellwrapper paddingtop 0pxnode95rgb25 168 230plpfieldprivacycheckbox fontsizebackgroundposition center centeruppercase letterspacing 01em992 plpscreen mdblock cursornode68paddingleftnode59padding 0 lineheightradiobefore opacitypaddingtop 0pximportant paddingbottomtransition all175px paddingleft 15pxjustifycontent spacebetweentransform scale08px borderwidth 2pxverticalalign top2px solidnode110 paddingrightbackgroundposition124 201bordertopleftradius 5pxbordertoprightradiuslineheight 1formcontrolfocuswithin bordercolor rgb22cover displayblock backgroundcolor white5ifcontent16px paddingleftnode15130px borderradius 3px83 145 0node91normal13px wordwrap breakwordtick node145metaplpfieldresult flexgridaligncenter left129paddingtopwidth 100 paddingtop145color rgb255 255colorplpfieldcheckboxlist span65px fontsizergb36 74 129paddingtopcursor pointer node145meta0px paddingright 0px7rgb230paddingleft 0pximportant paddingrightuppercase letterspacingrgba0left textalignrgb25 110 230rgba41 83paddingtop 40px paddingrightborderradius 5px padding25pximportant screenxs0pxborderleftwidthpaddingbottom 13px129color rgb255 2555pxborderstyleflexwrap wrap marginbottomplpfieldfile flexgrid centerrgb290 width145 050 transformflexgridalignright rightrgba115 163 247paddingtop 175pximportantnode91 selementsgridcellcell3wrapsolid bordercolor rgb255100 paddingtop5px paddingbottommiddle textdecoration noneplpfieldcheckboxlist label label255 255node119 selementsgridcellcell0 selementsgridcellwrappertransition all 300msabsolute width39px paddingleft 50px25node159backgroundcolor rgba22 102center node148meta plpfieldresultdashed color inherit163bordercolor rgb30absolute left 074 129paddingtop 5pxpaddingbottompaddingbottom 22pxpaddingtop 100node187rgb32 66right textalign centermargintopnone rgba0 00 01505 fontsizenode61width 50importantbordercolor rgb13 90solidbordertopwidth0 height 10015pximportant screenxs node29pointer zindextick position absoluteoverflow hidden node145metaopacity 0 node148metamargin 0 55px6white borderradius 100pxplpfield paddingbottom 14px50px overflowopen sans opacityinputhover checkbox50px overflow hidden1 screenxsnormal displayuppercasecolor rgb255norepeat colorpaddingright 0 screenxsplpfieldhidden opacity179 248plpfieldcheckboxvisual item widthmargin 00 0 5pxtexttransform uppercasecolor rgb255selementsgrid marginleftverticalalign middle0 lineheighthidden position relativenode148meta plpfieldcheckboxvisualif documentbodyclientwidth 1200backgroundcolor rgba10radionode38middle background white0pximportant screenxs node91rgb42 125 201bordertopleftradius0 leftsvg6screenxs node144meta plpfieldradiovisualcontent displayscale1checkbox svgfontweight normalplpfieldprivacycheckbox fontsize 8050 wordwrap breakwordplpfieldfile163 247borderbottomwidth 1px borderbottomstylebackgroundcolor rgb42 125255 255boxshadow 0pxinputfocus radiocenter borderradius14px145 0bordercolor rgb29sans opacitypaddingright 25pximportant161 0bordertopleftradiusnode144meta plpfieldradiovisual8px borderwidth241 05paddingtop 10px paddingbottom50 transform translate50backgroundcolor white borderradiusheight 22pxnode148meta plpfieldfilezindex 0relative transition 300ms8pxpaddingleft 24pxpaddingright 24pxfontsizefill rgb255 255borderradius 2px24pxpaddingrightspan displaypaddingright 25px node119node145meta plpfieldcheckboxvisualhidden node144meta47middle node148meta0 margin 0231 colorright opacity 05minheight auto43100 topinset 0px 2px182 2450 width 22px37px paddingright0pxborderstyle22px paddingleft42backgroundcolor rgba4520px paddingleftpaddingright 15px node29paddingbottom 175pxdefspositioncolor rgb225inherit cursorlgplpfieldradiovisual tick positionflexgrid center flexgrownode1023699 161paddingtop0important screenxs node9124rgb255selementsgridcellcell2 selementsgridcellwrapperoverflow hidden node148metadisplay block cursornode45node140node75selementsgridcellcell0 selementsgridcellwrapperfontweight normal fontfamily0 wordwrap breakwordmiddle background0 paddingright 0pxbackground white borderdocumentbodyclientwidth 1200 plpscreenplpfield0bordercolor rgb29 59wrapper2 backgroundcolor rgba10color rgb230 25relativenode145meta plpfieldprivacycheckbox20px justifycontent spacebetweenplpfieldcheckboxvisual tick positionwordwrap breakwordnode29 selementsgridcellcell11 node144meta plpfieldfile255 255 colorradio boxshadow insetlabel positionplpfieldfile input positionplpfieldcheckboxlist span verticalalignplpfieldcheckboxvisual itemplpfieldcheckboxvisual input0pxborderrightwidthbackgroundrepeattopnode145meta plpfieldcheckboxlist8pxpaddingbottom075 transitionwordwrap breakword texttransform0 overflow15px node2910pxpaddingrightverticalalign middle textdecorationpaddingbottom 10px paddingleftbgimage tick node145meta0 transition allmarginbottom 20px justifycontentrgb41 124 201bordertopleftradiusplpfieldcheckboxvisual bgimageabsolute leftborderradius 5pxnode17plpfieldselectmenutexttransform uppercasecolornode141wrapper1 wrapper2alignitems center node144meta20px lineheight 0input positionrgba10 20 35inputchecked radio bordercolor01em25pximportant1 transform scale1opacity 1 screenxspaddingright 30px paddingbottom125 201bordertopleftradius10pximportant paddingleft5pxbordertoprightradiusformcontrol heightinputfocus radio bordercoloralignitems center node148meta08245 colorplpfieldprivacybutton15pxabsolute width 00 55px 0path fill noneplpfieldselectmenu selectst0fillnonestrokergb255plpfieldcheckboxvisual subname marginnode29 selementsgridcellcell427defs path fillitems displaycolor rgb225 25plpfieldresult flexgridalignsides displaydisplay blockrgb138 179 2485 marginleft 4pxpaddingtop 37px0pximportant paddingrightflex flexwrap wrappaddingbottom 10pximportant08 marginbottomnode119 selementsgridcellcell2 selementsgridcellwrapperleftfontsize0 width 100rgba45 92node24255boxshadow 0pxplpfieldprivacytext fontsizefontsize 14px cursornode93pointer node144meta129paddingtop 5pxpaddingbottom25 230fff borderradius 8pxwidth 75node148meta plpfieldradiovisualwidth 100 top201bordertopleftradius 5pxbordertoprightradiuswidth 33333333333333336transition 300ms allblock cursor pointer10px whitespace nowrapverticalalign top textalignbackgroundcolor rgb255plpfieldselectmenu flexgrid0 5pxborderradius 3px50 wordwrap50importantcursor initialrelative transition0pximportant paddingleft26flexgrid centertexttransform0pxborderbottomleftradiusscreenxs node29wrapper2 paddingright 25pximportant1200 plpscreen lgmarginbottom 10px whitespaceplpfieldradiovisualrgb42 125rgb27 80nonerelative backgroundcolorcover backgroundrepeat repeatflex alignitems center26px positiontransform scale055px paddingbottom 22px0important screensm0 marginplpfieldradiovisual bgimage widthscreenxs node148meta plpfieldradiovisualwrapper2 paddingrightdisplay inlineblock backgroundpositionplpfieldfile inputpaddingright 5pxborderradius 100px12paddingbottom 20px paddingleftnode144plpfieldfile cleanhoverwidth 20px height33right flexgrow20pximportant paddingbottomopen sansnode104all borderradiusname fontweight normalcolor rgb230scale05backgroundcolor rgb34 101145 0bordercolor rgb32plpfieldcheckboxvisual inputchecked96pxopen textalign centerplpfieldcheckboxinputplpfieldradiovisual tickformcontrol formcontrol5pxborderbottomleftradiussvg opacity0bordercolor rgb29border 2px8pxpaddingleft1 minwidth 25plpfieldcheckboxlist0importantwordwrap056 paddingtop10px paddingbottom 10pxformcontrolplpfieldresult flexgridalignleft rightwhitespacenode8380 129color rgb255node40formcontrol formcontrol margintop100important paddingleft 15pximportantnode10rgb30 89backgroundcolor rgb41 124node144meta plpfieldselectmenunode7640pxpaddingbottom 14px fontsizeheight 20pxrgb245coverbackgroundcolor rgba41lineheight 12borderradius 8px borderwidthtick opacityinputhover radio80px175pximportant paddingleft5pxborderbottomrightradiusboxshadow nonecirclerectfillnone fill noneallplpfieldradiovisual overflow hiddenformcontrolfocuswithin bordercolorsvg23middle node144metawrapper2cookienode148meta inputcheckedcleanhover opacitywidth 50important paddingleftright opacity025color blackbackgroundcolor rgba45 921pxmiddle screenxsnode4inherit05 cursorinset 0letterspacingautonode13375 displayflexgridplpscreen lg0px paddingbottom 0pxname marginbottom 0width 20pxradio bordercoloruppercasecolorsubname margin 7px0 55pxpaddingtop 175px38st0fillnonestrokergb255 2550px 15px 17pxcenter opacitymiddle textdecorationrgb242 242 242paddingright 0px node91transform translate50 50flexwrapmarginbottom 65px fontsizerepeat color fff0pxborderbottomrightradius242 242formcontrolfocuswithinposition relative transition10pximportant paddingleft 0importantscale0border 2px solidinputchecked bgimage22100 textalign5pxpaddingleft 10pxpaddingrightnode29 selementsgridcellcell3rgb00px rgba0410 node75100 height 100backgroundcolor rgba41 8301em texttransform300ms all borderradiusplpfieldradiovisual subname marginformcontrolfocus01em texttransform uppercasecolor0bordertopleftradius 0pxbordertoprightradius 0pxborderbottomrightradiuspaddingright 5px paddingbottom0px 2px 5px65pxpaddingbottom 39px paddingleft0 top25px paddingright0 node91129color rgb255screenxs node148meta plpfieldcheckboxvisualnode144meta plpfieldresult181bordercolor rgb26paddingright 10px paddingbottomnode145metaselementsgridcellcell005 border 1pxnode117plpfieldradiovisual inputcheckedplpscreen mdpathfillnone0pximportant paddingleft 0importantscreensm92 161 0bordertopleftradiustextarea resizeheight 22px minheight325px paddingbottom 5px25pxlabel label margintopnode145meta plpfieldresultrgb25 100paddingtop 10pxrgb29 59 103colorlabel20px lineheighttextalign right fontsizenode29 selementsgridcellcell2opacity 08absolutemiddle node145metamarginleft 4pxnode1011px borderbottomstyle dashedplpfieldcheckboxvisual subname22px heightfontsize 80 cursorsubname width 75node13930px borderradius0px paddingbottomright textalign rightnode48opacity 0 node144metapaddingright 0px paddingbottomrectfillnonepaddingbottom 175px paddingleftcover backgroundrepeat norepeatbackgroundzindex 1wrapper2 paddingtop 40pxmargintop 5px marginbottom25pximportant paddingleftfontsize 14px fontfamilywrap marginbottomnode44node126 wrapper1 wrapper21 node145meta plpfieldfile110 230black webkitappearance181bordercolor rgb27 80verticalalign middle lineheightoverflow hidden node144metanode2inlineblock verticalalign top145color rgb255borderbottomstyle dashed color175pximportant paddingbottom0important screenxsfontsize 20pxplpfieldradiolistbackgroundcolor rgb42inlineblock verticalalign middle0 0 050 0fontsize 13pxright flexgrow 14paddingtop 175pximportant paddingbottom5px paddingrightbackgroundcolor rgb41paddingleft 0 paddingright0 wordwrapwrapper1 backgroundpositionpaddingtop 36px0px paddingright 5pxnode1913px paddingleft 5px0important screensm node119selementsgridcellwrapper paddingtop 175px124 201bordertopleftradius17paddingleft 0px paddingright4px 10px 0pxcolor rgba0 0paddingbottom 10pximportant paddingleftplpfieldcheckboxvisual input positionboxshadowbackgroundcolor rgb255 255span verticalalign middleflexgrid display flexnode134 wrapper1333 boxshadow 0px15pximportant screenxs node75node29 selementsgridcellcell0minwidth 25node128flexgridalignsides leftfill none013middle lineheightwrapper2 paddingtop 5pxtop 0 widthpointer node148meta50 paddingleft5pxborderbottomleftradius 5pxborderstyletransform scale1color rgb25 168marginbottom 10pxnode1460bordercolorplpfieldselectmenu select position0px paddingleftbackgroundrepeat norepeat colorboxshadow insetcheckbox svg opacityrgb37wordwrap breakword textaligninput position absolutepaddingright 036px paddingright15pximportantscreenxs node145meta plpfieldcheckboxvisualleft textalign rightcontent display blocknode132width 3020px paddingbottom0pxborderleftwidth 0pxborderrightwidthpaddingbottom 10pxplpfieldradiovisual overflowelse ifnone borderbottomwidthradiobefore positionjustifycontentfontweightnode111175px paddingleft 0node0radio margin 0paddingbottom 175pximportant paddingleft15px 17px 0pxrelative width 100paddingleft 50px screenxsrgb25 103 230rgb30 90node148meta plpfieldcheckboxlist300ms opacityflexgridalignsidesrgb255 25579 129color rgb255node18paddingtop 36px paddingright333 boxshadowleft flexgrowpaddingbottom 20pxpaddingleft 15pximportant screenmdnode116node1flexgrid left flexgrowcheckbox width 22pxnode97color fff5pxborderstyle solidbordertopwidth55px 0clean float right8pxpaddingleft 24pxpaddingrightscreenxsnode119 selementsgridcellcell24010pxmargin 7px1 node145metargb25 168paddingbottom 0pximportantplpfieldradiolist input positiondocumentbodyclientwidth 992selementsgridplpfieldradiovisual item widthwidth 75 displaycheckbox bordercolor rgb1396px fontsize 14pxalignitems center node145metawidth 22px height175pximportantinlineblockspan display inlineblocktextalign rightfillcontainersoft maxwidthpaddingbottom 14pxnode134height 22px paddingnode14node153plpfieldradiovisual input position92 161rgb26 79100 content display14100important0 0 paddingradio bordercolor rgb13margin 0 margininputhoverrgb34white borderpaddingbottom 0pxnode96display block backgroundcolorwrapper1 colorheight 80pxnode144meta plpfieldprivacycheckboxinputhover bgimage0 left 0paddingtop 20pximportantrgb27opacity 05241 backgroundcolorcleanhoverbackgroundcolor rgba22cover backgroundrepeat4px 10pxinputactive checkbox5 marginleftleft flexgrow 1solidbordertopwidth 0pxborderbottomwidthpointer node145metanode62svg width 100subname width0px paddingleft 0pxnode144metawhitebackgroundcolor rgb245 245rgba0 0 0tick positionborderbottomstyle dashedplpfieldprivacycheckbox input3relative zindexmd else if0px 4px 10px15pximportant paddingleft 15pximportantplpfieldhidden opacity 025height autopathpaddingright 25pximportant paddingleft0 transformif documentbodyclientwidth 992flexgrow 1node148meta3pxnode9 wrapper125 verticalalignpointer zindex 0inputfocus37pxpaddingright 0 node290 paddingright 15pxflexgridalignsides left nameformcontrol margintop 10pxposition absoluteplpfieldradiovisual items displayplpfieldfile flexgrid displaypaddingbottom 5px10px paddingbottom100 node148metarect fill rgb255node51flexgrow 1 minwidthcenter backgroundsize coverright textalign96px fontsize0px rgba22 102center node144metargb230 25100important paddingleftwhitespace nowrap screenxsrgb245 245selementsgridcellcell3 width 50rgb0 0 0borderradius 6pxmd else0pximportant paddingbottom 0pximportantrightscreenxs node144meta plpfieldcheckboxvisualpaddingright 0 node91span verticalaligncenter center backgroundsizenode144meta plpfieldfile0 screenxsrgb22node15rgb138 1790px 2pxnowrap screenxsrgb32 66 116colorsvg width 20pxtextalign center marginbottomtick svgminwidth 25 wordwraprectplpfieldresult161paddingtop 8pxpaddingbottom 8pxpaddingleftpaddingleft 5pxbgimage width 25height 100 contentplpfieldcheckboxlist labelspacebetween0pxborderbottomwidth 0pxborderleftwidth0px 4px25pximportant paddingright 25pximportantnode145meta plpfieldradiovisual5px paddingright 5px180important screenxs node2912 boxshadownone positionbgimage24pxfontsizecolor rgb25 110marginbottom 20px widthplpfieldselectmenu faselementsgridcellcell0 width 50paddingleft 15pxplpfieldfile span displaycenter center175px paddingbottom 175pxwrapper1node119 selementsgridcellcell1 selementsgridcellwrapperleft 0 topplpfieldprivacycheckbox span verticalalign145 0bordercolornode49float right opacitysvg22tick node148metaplpfieldfile cleanhover opacity100 top 01inputfocus bgimage tickplpfieldcheckboxlist input positionscreenxs node144metasvg8node58opacity 05 verticalalign34none rgba0width 100 opacityselementsgridcellcell1 width 100importantflexgridalignright left0pxbordertoprightradius 0pxborderbottomrightradius 0pxborderbottomleftradiusplpfieldradiovisual item display1 minwidthborderradiusnode39node1300bordertopleftradius 0pxbordertoprightradiuscleanhover opacity 1node145meta plpfieldselectmenunode119 selementsgridcellcell1top 50select position absolute129paddingtop 5pxpaddingbottom 5pxpaddingleftmiddlehidden positionnone position relativesubname margincursor pointerdocumentbodyclientwidth 768zindex 1 color20px width 30750pxitem widthpaddingleft 5wrapper2 paddingright 15pximportant5px paddingleft 10pxnode53node144meta plpfieldradiolistscreenmdposition absolute widthpaddingtop 20pximportant paddingbottombackgroundcolor white12 boxshadow none24pxpaddingright 24pxfontsizepaddingleft 15px paddingright245 245 colorpaddingleft 0pxsvg opacity 0paddingleft 30px borderradiuspaddingright 0important screenxs0 node145metacenter node145metaposition relativergba115 163025 borderradius 5pxwidth 100 textaligndivareascreenmdhidden node145metatop textalign centerflexgrid right0 0 lineheightboxshadow 0pxheight 0paddingbottom 30pxinset 0 00pxbordercolor rgb36displayscreenxs node145metadocumentbodyclientwidth 992 documentbodyclientwidthmarginbottom55pxformcontrol height autocolor inheritdisplay flex alignitemssvg widthpaddingleft 15pximportant paddingrightnode75 selementsgridcellcell1fffcursor pointer zindexnode144meta plpfieldcheckboxvisualtransform scale0 transitionrgb242 242node85textalign center node144metabreakword whitespacergb41 182 245paddingright 25pxnode35pxpaddingleft8pxpaddingbottom 8pxpaddingleft 24pxpaddingrightsvg20paddingbottom 16pxsanswebkitappearancergb230 25 25100pxbackgroundcolor rgb3325 paddingtoplineheight 026px position absolute0px rgba0 0opacity 025015verticalalign middle node145metanode12136px paddingright 50pxdocumentbodyclientwidth15node29documentbodyclientwidth 992 plpscreen992 plpscreen255 255strokewidth15strokelinecaproundstrokelinejoinroundstrokemiterlimit105pxbordertoprightradius 5pxborderbottomrightradius50px paddingbottom 39pxbackgroundsize cover backgroundrepeatleft marginbottomitem display inlineblock05 cursor pointer25 paddingtop 25background white0 node29checkbox boxshadow insetbordercolor rgb13815px paddingright 0select positionrelative widthwhite borderradiusbgimage tick opacitycolor rgb255px paddingbottom 16pxwidth 50clean300ms allpolygonfillnoneright textalign leftleft name marginbottom5px paddingbottom 13pxselementsgridcellcell2wrapper1 wrapper2 paddingrightpaddingtop 20px paddingbottom8pxnode127bordercolor rgb13bordercolor rgb22 102bgimage backgroundsize covernode1540pxbordertoprightradius100 161paddingtop 8pxpaddingbottomrgb26 79 129colorflexgrow0pximportant paddingright 0pximportantnode29 selementsgridcellcell5node157bordercolor rgb255 255rgb33backgroundcolor rgb37paddingleft 15pximportantrgb33 1002116colorhidden node148metaplpfieldradiovisual itemcontainersoft0 transform scale00 minheight autoopacity 0node1885pxborderbottomleftradius 5pxborderstyle solidbordertopwidthtop 0transition 300ms112 181bordercolorpaddingright 10px05 verticalalignnone borderbottomwidth 1pxplpfieldradiovisual itemswrapper1 backgroundposition center025 borderradiusdisplay flex flexwrap0pxborderstyle solidbordertopwidthscreenxs node119paddingright 15pximportant paddingleftplpfieldprivacytext fontsize 80selementsgridcellwrapper paddingtop 0pximportantnode145meta plpfieldfilecheckbox svg widthdisplay flexplpfieldradiolist label5px paddingleft 5pxcolor black webkitappearancergb25 1081 minwidth 50plpfieldcheckboxvisual bgimage backgroundsizeinputchecked radiobefore5px 0px0 overflow hiddendivareascreensmplpfieldcheckboxvisual overflow hiddenzindex0 025heightplpfieldselectmenu fa fontsizefa fontsize 20px20px paddingbottom 20px12pxcheckbox widthbgimage tick svgpaddingleft 25pximportantflexgrid displaynode155backgroundcolor rgb24225 wordwrap37px paddingright 30pxpaddingtop 0pxflexgridaligncenter125 201bordertopleftradius 5pxbordertoprightradiusinputactive radio boxshadow20 35wrapper1 color fffopacity 0 transformflexwrap wraprgba22 102 241selementsgridcellwrapper paddingtop 175pximportantwidth 25 paddingtopplpfieldcheckboxvisual labellabel fontweight normalfontfamily open sanspaddingbottom 0px paddingleft20pximportant paddingbottom 20pximportantplpscreen0important paddingright 0important0 cursor201bordertopleftradiusnode56selementsgridcellwrapper paddingtop 10pximportantrgb0 0168 230paddingleft 30pxalignitems centerpaddingleft 25pximportant paddingright100 backgroundcolorselementsgridcellcell2 selementsgridcellwrapper paddingtopborderwidth 2pxposition relative widthrgb255 255 255marginbottom 0paddingbottom 25pxpaddingbottom 16px paddingleft25pximportant paddingright 0important4622px minheight auto1px none5px paddingbottom 0pxplpfieldcheckboxvisual inputchecked bgimage2px borderstyle solid83 145 0bordercoloritem displaywrapper1 backgroundcolor rgb255radio boxshadowplpfieldcheckboxvisual bgimage widthplpfieldresult flexgridalignrightwrapper2 paddingtopradio margincenter marginbottom 20pxflexgridalignright right textalignnode3614px fontfamily opennormal fontfamilyborderbottomwidthflex flexwrapleft 05px paddingright 10px0 top 0241 backgroundcolor rgb242rgba22 102marginbottom 20px100 23010px paddingleftverticalalign middle paddingleftauto displaytexttransform uppercase0pxborderleftwidth 0pxborderrightwidth 0pxbordercolorminheight auto display50px screenxs300ms maxwidth 26pxwidth 25node43rgb25 108 230selementsgridcellcell1plpfieldradiovisual subname widthcenter node148metargb22 102inputchecked checkbox bordercolornode148meta plpfieldresultresize verticalif documentbodyclientwidthselementsgridcellwrapper paddingtop 10pxpaddingtop 30px102 241 0513pxnormal fontfamily opencolor fff borderradiusfontfamilybackgroundcolor rgba10 20black webkitappearance none300msnode75 selementsgridcellcell0textalign left marginbottomselementsgridcellcell1 selementsgridcellwrapperplpfieldcheckboxinput spancolor rgb25 103relative backgroundcolor rgb2452px 5px 0px163 247 013breakword texttransform13255 colorbackgroundsize cover displayall 300ms opacitybackgroundcolor rgb38 112paddingright 15px node75float50 paddingleft 0255boxshadowpaddingleft 0importantunderlinecolor39px paddingleftplpfieldfile span14px cursor initialnode84fontsize 80 textalignrgb255 255 255boxshadow20px justifycontent33333333333333336 paddingleft08 marginbottom 65px22px height 22px1200 plpscreenplpfieldresult flexgridaligncenterwrapper2 paddingtop 30pxflexgridaligncenter left textalignnode145scale0 transition 300msnode126 wrapper1padding 0 margin35selementsgridcellcell1 widthbackgroundcolor rgb33 100rgb138uppercase0pxborderbottomwidthnode89borderwidth 2px borderstylenode57selectpointer zindex 1plpfieldfile svg widthplpscreen lg elsepaddingbottom 22px paddingleftflexgridalignright left textalignnode13148width 100 heightborderradius 50pxinherit cursor pointerfa fontsize 23px0px node91flexgrid right flexgrowif plpscreens20all 300mstop textalignf15pximportant paddingrightbackgroundcolor rgb37 112100important paddingleft 25pximportantnode631 node144meta20 35 05630px paddingleft 30pxdisplay inlineblock verticalaligntextalignscreenxs node91lineheight 0 width14px fontsizeinlineblock backgroundpositionpaddingleft 15pximportant screensm40px paddingright 5pxinputheight 20px verticalalignplpfieldradiovisual label position13px wordwrappadding 0node94node148meta plpfieldprivacycheckboxflexborderbottomstyle14px fontsize 14pxnode16blocknode150rgba41top 50 transformwidth 100important paddingleft66 116colorflexgridaligncenter leftfloat rightpaddingtop 175px paddingbottomradio bordercolor rgb1387px 0 wordwrapnode115documentbodyclientwidth 768 documentbodyclientwidthpaddingbottom 20pximportantnode64node55absolute top992 documentbodyclientwidthplpfieldradiovisual bgimage20px height 20pxplpfieldprivacybutton open textalignborder 1px none17pxplpfieldcheckboxvisual inputfocus bgimagebackgroundrepeat norepeat7px 040px paddingrightnode113plpfieldcheckboxvisual overflow20px verticalalign middle181bordercolor rgb26 79paddingbottom 20pximportant paddingleft30px paddingbottom 30pxrgb13 90 223node90checkbox bordercolor rgb138polygon16px25 verticalalign middleselementsgridcellcell2 widthopacity 1 transform20px width15pximportant paddingright 15pximportantpaddingbottom 25px paddingleftbackgroundrepeat repeat color0 height0 node144metaplpfieldradiovisual subname300ms maxwidthcolor 333 boxshadow1 color blackauto display inlineblocknode91 selementsgridcellcell0color rgb25 100backgroundposition center borderradiusinputfocus bgimageposition relative zindexwidth 100important255boxshadow 0px 4pxbordercolor rgb255rgb29 59161 0bordertopleftradius 0pxbordertoprightradiusminwidthplpscreensnode91 selementsgridcellcell2backgroundcolor rgb380pxbordertoprightradius 0pxborderbottomrightradiusplpfieldcheckboxinput span verticalalignrect fill0pxborderbottomwidth 0pxborderleftwidth 0pxborderrightwidthnode5080 textalignnode37opacity 05 fontsize255boxshadow inset31label margintoprgba45bgimage widthinputfocus checkboxwidth 22pxfill rgb255rgb22550 paddingleft 15pxcenterplpfieldselectmenu flexgrid displaypaddingbottom 30px paddingleftnode137paddingtop 0px paddingbottomnode148position relative backgroundcolor5pxborderstyle solid bordercolormaxwidth 26px positionleft 50 topcheckbox bordercolor129color15pximportant screenxs2px solid rgba0100 opacity 0textdecoration none15pximportant screenmdplpfieldradiovisual tick svglabel margintop 7333333333333333pxbreakword textalignlabel labelbackgroundposition center0important paddingright 25pximportant201bordertopleftradius 5pxbordertoprightradius 5pxborderbottomrightradius80 cursorinputchecked checkbox0pxborderrightwidth 0pxbordercolor rgb36paddingleft 50px0pxradiobefore position absolutepaddingright 15pxtransform translate50rgb2555px 0 0svg21solid bordercolordashedbackgroundcolor rgb22 102wrap marginbottom 20pxlineheight 0 opacitysolid rgba00px paddingright20pximportant10px 0px rgba22paddingright 30pxpaddingbottom 0pximportant paddingleftdivareascreenlgplpfieldfile cleannode1265pxpaddingleft 10pxpaddingright 10pxfontsize102 241inputchecked bgimage tickflexgridalignleft right textalign100 contentinputchecked checkbox svgnode60selementsgridcellcell0 width 100important102 241 075width 100top 0 height181bordercolor223 backgroundcolor rgb22paddingbottom 39pxrgb13 9013px paddingleftbordercolorlineheight 12 boxshadownode148meta plpfieldselectmenupadding height 80pxplpfieldcheckboxvisual inputhover bgimage255boxshadow inset 0px100 height10pximportantflex alignitems12px 96px fontsize25pximportant screenxs node119sans opacity 08100px opacityrgba115lineheight 0 minheightpaddingbottom 175pximportantborderstyle solidfff borderradiusheight 100paddingbottom 13px paddingleftnode91 selementsgridcellcell1161paddingtop 8pxpaddingbottomleft 0 width29position absolute left82pxspan0pxborderrightwidth 0pxbordercolor0 5px rgba016px paddingleft 5px30node1230px paddingbottom 25px5px rgba0verticalrgb2610pxpaddingright 10pxfontsizeplpfieldradiovisual inputhover30px paddingbottom175px paddingbottomfontfamily opencontainer width175px175pximportant paddingbottom 175pximportantinitialpaddingright 50pxplpfieldradiolist input0pximportant4pxverticalalignplpfieldfile svg10pxfontsizedocumentbodyclientwidth 1200plpfieldcheckboxvisual items displayrgb13075 transition alllg elseborder 1pxmargintop 7333333333333333px103 230node75 selementsgridcellcell2100 opacityplpfieldresult flexgridalignsideslg else if23pxpaddingtop 5px paddingrightdashed colorcenter node144meta plpfieldresult17px 0pxpaddingrightboxshadow 0px 15pxrgba10 20uppercasecolor rgb255 25505 fontsize 80100 backgroundcolor rgba2225px paddingleft 30pxwrapper2 backgroundcolor5px paddingleftcursor pointer node148metaplpfieldfile clean floatnode119 selementsgridcellcell2 widthheight 100 backgroundcolor22pxwhitespace nowrap0pximportant screenxscenter backgroundsizest0fillnonestrokergb255 255 255strokewidth15strokelinecaproundstrokelinejoinroundstrokemiterlimit10selementsgridcellwrapper paddingtop 20pxbackgroundcolor22px minheight0pximportant paddingbottomselementsgridcellcell0 widthheight 0 opacityselementsgridcellcell2 width 50node88wrapper1 wrapper2 paddingtop2px borderstyleopacity 0 overflow1 transform scale05node136rgb37 112 181bordercolor0bordercolor rgb32175pximportant paddingleft 0importantformcontrol margintop0pxbordercolor rgb36 7416maxwidth 26pxtexttransform uppercase letterspacing30px paddingrightnode12050pxlabel position relativehiddenrgb25 110borderradius 50px overflownorepeat color fff0 lineheight 0paddingtop74 129paddingtopwidthwhite border 2pxborderradius 100px opacitypaddingbottomminheightplpfieldselectmenu flexgrid left20px verticalalign30px borderradius 6pxplpfieldradiolist label label5pxpaddingbottom 5pxpaddingleft 10pxpaddingrightleft marginbottom 10pxplpfieldcheckboxvisual items0 05plpfieldresult flexgridalignright rightsubname80 cursor pointer5pxborderstyle solidbordertopwidth 0pxborderbottomwidthselementsgridcellcell3 width 100importantminwidth 50100 161paddingtoppaddingright 50px paddingbottomplpfieldcheckboxvisual item display30pxpaddingright 0 node75relative zindex 1auto lineheight30px paddingright 30pxnode103paddingtop 40pxcenter node145meta plpfieldresult35 056 paddingtoppaddingright 0px8pxpaddingbottom 8pxpaddingleftblock backgroundcolor5px 0px rgba0node144meta inputcheckedinset 0px45normal display blockleft nametextalign center node145metaplpfieldresult flexgridalignleftpaddingtop 5pxbgimage backgroundsizeelsergb320pxborderbottomleftradius 0pxborderstyle solidbordertopwidthtransitionpaddingleft 0important paddingright05 verticalalign middle50important paddingleft245 color rgba0paddingright 0importantrgb25 1031 transform0 0 02550px paddingbottomopacity 05 cursor50 top 50rgb34 101overflowflexgrid leftbackgroundcolor rgb242 2425pxpaddingbottom 5pxpaddingleftpaddingleft 10px5pxborderbottomrightradius 5pxborderbottomleftradius0px rgba115svg opacity 1textareaauto lineheight 12103color0 padding2px 5px0 025 borderradius22px paddingleft 5px7333333333333333px0px rgba225pxpaddingbottom44flexgridaligncenter right textalignnode134 wrapper1 wrapper2plpfieldradiovisual inputchecked bgimagepaddingleft 25px paddingrightsvg7height 100 opacityheight auto lineheightnode4119node98textarea resize vertical22px paddingcenter marginbottomplpfieldcheckboxinput input position9paddingtop 10pximportant paddingbottomwordwrap breakword whitespacefontsize 14pxall 300ms maxwidthcirclefillnone0 padding 0item width 100node15231pxmargintop 5px255strokewidth15strokelinecaproundstrokelinejoinroundstrokemiterlimit100pxborderbottomrightradius 0pxborderbottomleftradius 0pxborderstylenode87clean floattextalign center opacity1px none rgba0fontsize 20px lineheightverticalalign middle backgroundwrapper2 paddingtop 0pxnode144meta plpfieldcheckboxlist100 paddingtop 100node135rgb25 100 23010px 0pxplpfieldcheckboxvisual subname width15px node75mdnode112inputcheckedrgb33 99 161paddingtopplpfieldcheckboxvisual tick svg80 129color59 103color112 181bordercolor rgb26bgimage tickplpfieldcheckboxvisual inputhovername fontweightwebkitappearance none05else if documentbodyclientwidthtick svg opacityrgb245 245 245verticalalign middle node148metargb36 74backgroundrepeat repeat

Longtail Keyword Density for Cleanin-grad.ru

KeywordsOccurences
wrapper1 wrapper2 padding-top111
padding-right 5px padding-bottom80
wrapper2 padding-top 5px66
padding-top 5px padding-right66
wrapper1 color fff62
5px padding-right 5px62
padding-bottom 5px padding-left59
color rgb25 10855
5px padding-bottom 5px55
rgb25 108 23055
5px padding-left 5px54
wrapper1 color 33342
rgb255 255 25529
padding-bottom 0px padding-left27
rgba0 0 025
padding-top 0px padding-right23
wrapper2 padding-top 0px23
color rgb230 2521
rgb230 25 2521
input position absolute21
display inline-block vertical-align21
padding-left 0important padding-right20
0px padding-bottom 0px19
absolute width 018
position absolute width18
width 0 height18
0 height 018
height 0 opacity18
0 opacity 018
width 100important padding-left17
0px padding-left 0px17
0important padding-right 0important17
rgb25 110 23017
padding-left 0 padding-right17
color rgb25 11017
padding-right 0px padding-bottom16
0px padding-right 0px16
0 0 02515
0 width 10015
position absolute left15
inline-block vertical-align middle15
width 50 padding-left14
padding-right 0important screen-xs13
color rgb225 2512
0 overflow hidden12
tick svg opacity12
inputchecked bgimage tick12
span vertical-align middle12
transition all 300ms12
100 height 10012
width 100 height12
transition 300ms all12
opacity 0 overflow12
rgba41 83 14512
rgb225 25 23012
rgba22 102 24112
background-color rgba41 8312
15pximportant padding-right 15pximportant10
padding-right 15pximportant screen-xs10
padding-left 15pximportant padding-right10
100important padding-left 15pximportant10
color fff border-radius10
wrapper1 wrapper2 background-color10
15px padding-right 010
center center background-size10
background-position center center10
wrapper1 background-position center10
0 padding-right 15px10
padding-left 30px border-radius10
padding-left 15px padding-right10
padding-right 30px padding-bottom10
rgb22 102 24110
rgba10 20 359
rgb255 255 255box-shadow9
flex-grow 1 min-width9
background-color rgba10 209
svg opacity 19
wrapper2 background-color rgba109
s-elements-gridcellcell-1 s-elements-gridcellwrapper padding-top9
s-elements-gridcellcell-2 s-elements-gridcellwrapper padding-top9
wrapper1 wrapper2 padding-right9
left 0 width9
background-size cover background-repeat9
display flex align-items9
flex align-items center9
100 opacity 09
center background-size cover9
s-elements-gridcellcell-0 s-elements-gridcellwrapper padding-top9
absolute left 09
solidborder-top-width 0pxborder-bottom-width 0pxborder-left-width8
5px padding-bottom 0px8
0pxborder-bottom-width 0pxborder-left-width 0pxborder-right-width8
0pxborder-left-width 0pxborder-right-width 0pxborder-color8
0px padding-left 5px8
83 145 0border-color8
rectfillnone fill none7
color rgb25 1687
background-repeat repeat color7
rgb25 168 2307
fill rgb255 2557
path fill none7
0px padding-right 5px7
else if documentbodyclientwidth7
50 padding-left 07
defs path fill7
0px rgba0 07
rect fill rgb2557
inline-block background-position center6
vertical-align middle background6
relative width 1006
position relative width6
50px overflow hidden6
55px 0 06
display inline-block background-position6
overflow hidden position6
100 padding-top 1006
background-position center border-radius6
center border-radius 50px6
hidden position relative6
0 line-height 06
min-height auto display6
border-radius 50px overflow6
auto display inline-block6
width 100 padding-top6
border-color rgb13 906
tick position absolute6
22px height 22px6
26px position absolute6
max-width 26px position6
300ms max-width 26px6
all 300ms max-width6
0 transition all6
opacity 0 transition6
svg opacity 06
width 22px height6
300ms opacity 06
all 300ms opacity6
075 transition all6
left 0 top6
241 075 transition6
102 241 0756
background-color rgba22 1026
100 background-color rgba226
height 100 background-color6
background-size cover display6
top 0 width6
0 top 06
0 margin 06
margin 0 55px6
0 55px 06
cover display inline-block6
text-align center margin-bottom6
bgimage background-size cover6
15pximportant padding-left 15pximportant6
opacity 0 transform6
0 transform scale06
transform scale0 transition6
left 50 top6
padding-bottom 20pximportant padding-left6
20pximportant padding-bottom 20pximportant6
wrapper2 padding-right 15pximportant6
padding-top 20pximportant padding-bottom6
s-elements-gridcellwrapper padding-top 20pximportant6
scale0 transition 300ms6
padding-right 15pximportant padding-left6
border-color rgb138 1796
relative transition 300ms6
rgb138 179 2486
opacity 1 transform6
0 0 0156
5px rgba0 06
0 5px rgba06
0 0 5px6
inset 0 06
box-shadow inset 06
background-color rgb22 1026
223 background-color rgb226
padding-left 25pximportant padding-right6
90 223 background-color6
300ms all border-radius6
position relative transition6
label position relative6
vertical-align top text-align6
20px width 306
middle background white6
background white border6
white border 2px6
border 2px solid6
2px solid rgba06
margin-bottom 20px width6
center margin-bottom 20px6
solid rgba0 06
rgb13 90 2236
top text-align center6
font-family open sans6
overflow hidden node144meta6
inline-block vertical-align top6
item display inline-block6
-20px justify-content space-between6
margin-bottom -20px justify-content6
wrap margin-bottom -20px6
flex-wrap wrap margin-bottom6
0 025 position6
flex flex-wrap wrap6
display flex flex-wrap6
items display flex6
label margin-top 7333333333333333px6
label label margin-top6
absolute left 506
025 position relative6
50 top 506
middle padding-left 56
height 100 opacity6
0 left 06
top 0 left6
0px 2px 5px6
2px 5px 0px6
5px 0px rgba06
absolute top 06
position absolute top6
plp-fieldradio-visual inputchecked bgimage6
5 margin-left -4px6
padding-left 5 margin-left6
vertical-align middle padding-left6
129color rgb255 2556
75 display inline-block6
top 50 transform6
padding height 80px6
wrapper2 padding-top 40px6
padding-top 40px padding-right6
40px padding-right 5px6
5px padding-bottom 16px6
padding-bottom 16px padding-left6
16px padding-left 5px6
cover background-repeat repeat6
repeat color fff6
opacity 0 cursor6
0 cursor pointer6
20 35 0566
1px border-bottom-style dashed6
overflow hidden node148meta6
overflow hidden node145meta6
padding height 20px6
inherit cursor pointer6
color inherit cursor6
dashed color inherit6
201border-top-left-radius 5pxborder-top-right-radius 5pxborder-bottom-right-radius6
5pxborder-top-right-radius 5pxborder-bottom-right-radius 5pxborder-bottom-left-radius6
5pxborder-bottom-right-radius 5pxborder-bottom-left-radius 5pxborder-style6
5pxborder-bottom-left-radius 5pxborder-style solidborder-top-width6
border-bottom-style dashed color6
border-bottom-width 1px border-bottom-style6
cursor pointer z-index6
none border-bottom-width 1px6
text-decoration none border-bottom-width6
50 word-wrap break-word6
min-width 50 word-wrap6
1 min-width 506
255 255box-shadow 0px6
0px 4px 10px6
4px 10px 0px6
10px 0px rgba226
0px rgba22 1026
102 241 056
flexgrid display flex6
fff border-radius 6px6
width 75 display6
35 056 padding-top6
bgimage tick svg6
padding-top 175pximportant padding-bottom6
175pximportant padding-bottom 175pximportant6
padding-bottom 175pximportant padding-left6
175pximportant padding-left 0important6
10px white-space nowrap6
left margin-bottom 10px6
text-align left margin-bottom6
100 text-align left6
width 100 text-align6
item width 1006
opacity 1 screen-xs6
plp-fieldcheckbox-visual inputchecked bgimage6
15pximportant screen-xs node296
tick opacity 056
bgimage tick opacity6
inputhover bgimage tick6
break-word white-space normal6
word-wrap break-word white-space6
0 word-wrap break-word6
7px 0 word-wrap6
margin 7px 06
subname margin 7px6
transform translate-50 -506
50 transform translate-506
s-elements-gridcellwrapper padding-top 175pximportant6
margin-bottom 10px white-space6
white-space nowrap screen-xs6
padding-bottom 25px padding-left6
bgimage width 256
subname width 756
30px border-radius 3px6
175px padding-bottom 175px6
padding-bottom 175px padding-left6
vertical-align middle screen-xs6
padding-right 15px node296
25px padding-left 30px6
25 vertical-align middle6
padding-top 175px padding-bottom6
30px padding-bottom 25px6
padding-top 25 vertical-align6
37px padding-right 30px6
25 padding-top 256
padding-top 37px padding-right6
width 25 padding-top6
s-elements-gridcellcell-3 s-elements-gridcellwrapper padding-top6
s-elements-gridcellwrapper padding-top 175px6
vertical-align middle node145meta5
vertical-align middle node148meta5
50 padding-left 15px5
padding-right 0 node295
wrapper2 padding-top 30px5
056 padding-top 37px5
vertical-align middle node144meta5
0important screen-xs node295
background-color rgb38 1125
rgb25 100 2305
padding-bottom 10px padding-left5
st0fillnonestrokergb255 255 255stroke-width15stroke-linecaproundstroke-linejoinroundstroke-miterlimit105
20pximportant padding-left 0important5
color rgb25 1005
background-color rgb37 1125
161padding-top 8pxpadding-bottom 8pxpadding-left5
cursor pointer node144meta4
lg else if4
plpscreen lg else4
md else if4
plpscreen md else4
else if plpscreens4
opacity 0 node148meta4
cursor pointer node148meta4
opacity 0 node144meta4
0pxborder-top-right-radius 0pxborder-bottom-right-radius 0pxborder-bottom-left-radius4
opacity 0 node145meta4
5px padding-left 10px4
10px padding-bottom 5px4
padding-right 10px padding-bottom4
5px padding-right 10px4
border-color rgb22 1024
cursor pointer node145meta4
0border-top-left-radius 0pxborder-top-right-radius 0pxborder-bottom-right-radius4
255box-shadow 0px 4px4
5px padding-bottom 22px4
background-color rgb245 2454
background-color rgb33 1004
padding-right 25pximportant screen-xs4
25pximportant screen-xs node1194
rgb37 112 181border-color4
node126 wrapper1 wrapper24
22px padding-left 5px4
padding-bottom 22px padding-left4
10pximportant padding-left 0important4
245 245 color4
padding-bottom 10pximportant padding-left4
10pximportant padding-bottom 10pximportant4
padding-top 10pximportant padding-bottom4
145color rgb255 2554
15pximportant screen-xs node754
padding-right 15px node754
5pxborder-style solidborder-top-width 0pxborder-bottom-width4
10px padding-bottom 10px4
rgb245 245 2454
padding-left 0px padding-right4
s-elements-gridcellwrapper padding-top 10px4
padding-top 0pximportant padding-bottom4
background-color rgb34 1014
padding-bottom 20px padding-left4
161 0border-top-left-radius 0pxborder-top-right-radius4
node134 wrapper1 wrapper24
node130 wrapper1 wrapper24
0pximportant padding-left 0important4
padding-bottom 0pximportant padding-left4
0pximportant padding-bottom 0pximportant4
s-elements-gridcellwrapper padding-top 0pximportant4
0px padding-right 04
0pximportant screen-xs node914
padding-right 0pximportant screen-xs4
0pximportant padding-right 0pximportant4
padding-left 0pximportant padding-right4
100important padding-left 0pximportant4
padding-right 0px node914
0 padding-right 0px4
padding-top 0px padding-bottom4
s-elements-gridcellwrapper padding-top 0px4
padding-top 10px padding-bottom4
s-elements-gridcellwrapper padding-top 10pximportant4
92 161 0border-top-left-radius4
5pxpadding-bottom 5pxpadding-left 10pxpadding-right4
0pxborder-bottom-right-radius 0pxborder-bottom-left-radius 0pxborder-style4
0pxborder-bottom-left-radius 0pxborder-style solidborder-top-width4
0pxborder-style solidborder-top-width 0pxborder-bottom-width4
padding-top 30px padding-right4
border-color rgb255 2554
solid border-color rgb2554
30px border-radius 6px4
5pxpadding-left 10pxpadding-right 10pxfont-size4
129padding-top 5pxpadding-bottom 5pxpadding-left4
30px padding-right 30px4
74 129padding-top 5pxpadding-bottom4
border-style solid border-color4
0pxborder-right-width 0pxborder-color rgb364
0pxborder-color rgb36 744
2px border-style solid4
rgb36 74 129padding-top4
border-radius 8px border-width4
rgba45 92 1614
fff border-radius 8px4
background-color rgba45 924
8px border-width 2px4
rgb29 59 103color4
30px padding-left 30px4
padding-bottom 30px padding-left4
83 145 04
rgb32 66 116color4
0border-color rgb32 664
145 0border-color rgb324
0border-color rgb29 594
145 0border-color rgb294
s-elements-gridcellcell-0 width 100important4
30px padding-bottom 30px4
inset 0px 2px4
rgb38 112 181border-color4
s-elements-gridcellcell-1 width 100important4
s-elements-gridcellcell-2 width 100important4
border-width 2px border-style4
rgb27 80 129color3
80 129color rgb2553
flexgrid left flex-grow3
left flex-grow 13
181border-color rgb27 803
plp-fieldselect-menu flexgrid left3
line-height 0 opacity3
plp-fieldselect-menu flexgrid display3
112 181border-color rgb273
05 vertical-align middle3
align-items center node144meta3
opacity 05 vertical-align3
0 opacity 053
20px line-height 03
pointer z-index 13
font-size 20px line-height3
fa font-size 20px3
plp-fieldselect-menu fa font-size3
black -webkit-appearance none3
1 color black3
z-index 1 color3
color black -webkit-appearance3
none position relative3
fa font-size 23px3
plp-fieldradio-visual item display3
plp-fieldcheckbox-visual subname width3
s-elements-gridcellcell-0 width 503
no-repeat color fff3
background-repeat no-repeat color3
cover background-repeat no-repeat3
plp-fieldcheckbox-input span vertical-align3
plp-fieldcheckbox-input input position3
plp-fieldradio-list span vertical-align3
plp-fieldradio-list input position3
plp-fieldradio-list label label3
plp-fieldradio-visual overflow hidden3
plp-fieldradio-visual items display3
plp-fieldradio-visual label position3
255 255box-shadow inset3
uppercasecolor rgb255 2553
plp-fieldradio-visual input position3
plp-fieldradio-visual tick position3
plp-fieldradio-visual tick svg3
plp-fieldradio-visual subname margin3
plp-fieldradio-visual inputhover bgimage3
255box-shadow inset 0px3
screen-xs node144meta plp-fieldradio-visual3
plp-fieldradio-visual item width3
plp-fieldradio-visual bgimage width3
plp-fieldradio-visual subname width3
plp-fieldselect-menu select position3
select position absolute3
plp-fieldradio-visual bgimage background-size3
-5px margin-bottom -5px3
text-transform uppercasecolor rgb2553
80 cursor pointer3
rgb42 125 201border-top-left-radius3
125 201border-top-left-radius 5pxborder-top-right-radius3
rgb34 100 161padding-top3
100 161padding-top 8pxpadding-bottom3
8pxpadding-bottom 8pxpadding-left 24pxpadding-right3
8pxpadding-left 24pxpadding-right 24pxfont-size3
middle text-decoration none3
vertical-align middle text-decoration3
plp-fieldprivacy-checkbox a vertical-align3
plp-fieldprivacy-checkbox span vertical-align3
plp-fieldprivacy-checkbox font-size 803
font-size 80 cursor3
plp-fieldprivacy-checkbox input position3
05 font-size 803
opacity 05 font-size3
center opacity 053
text-align center opacity3
open text-align center3
plp-fieldprivacy-button open text-align3
right text-align right3
flexgridalign-right right text-align3
plp-fieldresult flexgridalign-right right3
right text-align center3
flexgridalign-center right text-align3
plp-fieldresult flexgridalign-center right3
background-color rgb42 1253
plp-fieldprivacy-text font-size 803
flexgridalign-left right text-align3
screen-xs node148meta plp-fieldradio-visual3
documentbodyclientwidth 768 documentbodyclientwidth3
1200 plpscreen lg3
documentbodyclientwidth 1200 plpscreen3
if documentbodyclientwidth 12003
992 plpscreen md3
documentbodyclientwidth 992 plpscreen3
if documentbodyclientwidth 9923
text-align center node148meta3
center node148meta plp-fieldresult3
1 node148meta plp-fieldfile3
align-items center node148meta3
screen-xs node148meta plp-fieldcheckbox-visual3
font-size 80 text-align3
bgimage tick node148meta3
text-align center node145meta3
center node145meta plp-fieldresult3
1 node145meta plp-fieldfile3
align-items center node145meta3
screen-xs node145meta plp-fieldradio-visual3
screen-xs node145meta plp-fieldcheckbox-visual3
bgimage tick node145meta3
rgb41 182 2453
plp-fieldhidden opacity 0253
plp-fieldprivacy-text a text-decoration3
80 text-align center3
right text-align left3
plp-fieldresult flexgridalign-left right3
01em text-transform uppercasecolor3
middle line-height 13
pointer position relative3
cursor pointer position3
05 cursor pointer3
opacity 05 cursor3
right opacity 053
float right opacity3
clean float right3
plp-fieldfile clean float3
pointer z-index 03
plp-fieldfile input position3
1 node144meta plp-fieldfile3
vertical-align middle line-height3
relative z-index 13
span display inline-block3
plp-fieldfile span display3
s-elements-gridcellcell-1 width 503
margin-top -5px margin-bottom3
middle margin-top -5px3
vertical-align middle margin-top3
20px vertical-align middle3
height 20px vertical-align3
20px height 20px3
width 20px height3
svg width 20px3
plp-fieldfile svg width3
position relative z-index3
plp-fieldfile cleanhover opacity3
text-align right font-size3
left text-align center3
break-word text-align right3
word-wrap break-word text-align3
25 word-wrap break-word3
min-width 25 word-wrap3
1 min-width 253
right flex-grow 13
flexgrid right flex-grow3
plp-fieldresult flexgrid right3
left text-align right3
flexgridalign-right left text-align3
plp-fieldresult flexgridalign-right left3
text-align center node144meta3
flexgridalign-center left text-align3
cleanhover opacity 13
plp-fieldresult flexgridalign-center left3
name margin-bottom 03
left name margin-bottom3
flexgridalign-sides left name3
plp-fieldresult flexgridalign-sides left3
center node144meta plp-fieldresult3
flexgridalign-sides display flex3
plp-fieldresult flexgridalign-sides display3
center flex-grow 13
flexgrid center flex-grow3
plp-fieldfile flexgrid center3
plp-fieldfile flexgrid display3
175px padding-left 03
padding-right 0 node753
175px padding-left 15px3
font-size 14px font-family3
100important padding-left 25pximportant3
width 100 opacity3
svg width 1003
checkbox svg width3
all border-radius 2px3
25pximportant padding-right 25pximportant3
plp-field padding-bottom 14px3
padding-bottom 14px font-size3
14px font-size 14px3
14px font-family open3
0important screen-sm node1193
name font-weight normal3
font-weight normal font-family3
normal font-family open3
open sans opacity3
sans opacity 083
opacity 08 margin-bottom3
08 margin-bottom 65px3
margin-bottom 65px font-size3
65px font-size 13px3
0important padding-right 25pximportant3
inputfocus checkbox border-color3
13px word-wrap break-word3
padding-right 25px node1193
node119 s-elements-gridcellcell-0 width3
width 33333333333333336 padding-left3
checkbox svg opacity3
inputchecked checkbox svg3
padding-left 25px padding-right3
node119 s-elements-gridcellcell-0 s-elements-gridcellwrapper3
s-elements-gridcellwrapper padding-top 20px3
padding-top 20px padding-bottom3
20px padding-bottom 20px3
checkbox box-shadow inset3
checkbox border-color rgb1383
inputactive checkbox box-shadow3
node119 s-elements-gridcellcell-1 width3
node119 s-elements-gridcellcell-1 s-elements-gridcellwrapper3
node119 s-elements-gridcellcell-2 width3
node119 s-elements-gridcellcell-2 s-elements-gridcellwrapper3
width 50important padding-left3
checkbox border-color rgb133
inputchecked checkbox border-color3
25pximportant padding-right 0important3
padding-right 0important screen-sm3
font-size 13px word-wrap3
0 min-height auto3
radio margin 03
border-radius 5px padding3
12 box-shadow none3
box-shadow none position3
form-controlfocus-within border-color rgb223
14px cursor initial3
font-size 14px cursor3
96px font-size 14px3
12px 96px font-size3
padding 12px 96px3
5px padding 12px3
025 border-radius 5px3
241 background-color rgb2423
0 025 border-radius3
none rgba0 03
1px none rgba03
border 1px none3
05 border 1px3
0 05 border3
0 0 053
color rgba0 03
245 color rgba03
relative background-color rgb2453
102 241 background-color3
background-color rgb242 2423
line-height 0 min-height3
height auto line-height3
word-wrap break-word text-transform3
0 0 line-height3
break-word text-transform uppercase3
text-transform uppercase letter-spacing3
uppercase letter-spacing 01em3
form-control height auto3
padding 0 margin3
22px padding 03
height 22px padding3
auto line-height 123
rgb242 242 2423
checkbox width 22px3
textarea resize vertical3
line-height 12 box-shadow3
block cursor pointer3
display block cursor3
normal display block3
font-weight normal display3
label font-weight normal3
form-control margin-top 10px3
form-control form-control margin-top3
1 transform scale13
margin 0 margin3
s-elements-gridcellcell-2 width 503
wrapper1 background-color rgb2553
plp-fieldcheckbox-visual input position3
0important screen-xs node913
color rgb25 1033
plp-fieldcheckbox-visual bgimage background-size3
rgb25 103 2303
plp-fieldcheckbox-visual label position3
5px padding-bottom 13px3
padding-bottom 13px padding-left3
13px padding-left 5px3
background-color rgb255 2553
padding-right 0 node913
255 255 color3
255 color 3333
plp-fieldcheckbox-visual item display3
color 333 box-shadow3
333 box-shadow 0px3
box-shadow 0px 15px3
0px 15px 17px3
15px 17px 0px3
17px 0px rgba1153
0px rgba115 1633
plp-fieldcheckbox-visual tick position3
rgb0 0 03
plp-fieldcheckbox-visual overflow hidden3
plp-fieldcheckbox-visual inputhover bgimage3
s-elements-gridcellcell-3 width 503
padding-right 0 screen-xs3
plp-fieldcheckbox-visual bgimage width3
s-elements-gridcellcell-3 width 100important3
plp-fieldcheckbox-visual item width3
screen-xs node144meta plp-fieldcheckbox-visual3
inputfocus bgimage tick3
plp-fieldcheckbox-visual inputfocus bgimage3
bgimage tick node144meta3
position relative background-color3
79 129color rgb2553
plp-fieldcheckbox-visual subname margin3
0important screen-xs node753
background-color rgb41 1243
rgb41 124 201border-top-left-radius3
plp-fieldcheckbox-visual tick svg3
124 201border-top-left-radius 5pxborder-top-right-radius3
rgb33 99 161padding-top3
112 181border-color rgb263
181border-color rgb26 793
rgb26 79 129color3
plp-fieldcheckbox-visual items display3
rgba115 163 2473
0 0 padding3
100 top 03
white border-radius 100px3
background-color white border-radius3
block background-color white3
display block background-color3
content display block3
100 content display3
height 100 content3
0 height 1003
top 0 height3
width 100 top3
100px opacity 03
padding-right 25pximportant padding-left3
25pximportant padding-left 25pximportant3
radiobefore position absolute3
all border-radius 100px3
22px min-height auto3
height 22px min-height3
0 width 22px3
line-height 0 width3
padding 0 line-height3
0 padding 03
border-radius 100px opacity3
inputfocus radio border-color3
163 247 0133
padding-left 15pximportant screen-sm3
plp-fieldcheckbox-list label label3
wrapper2 padding-top 36px3
padding-top 36px padding-right3
36px padding-right 50px3
padding-right 50px padding-bottom3
50px padding-bottom 39px3
padding-bottom 39px padding-left3
39px padding-left 50px3
padding-left 50px screen-xs3
plp-fieldcheckbox-list input position3
radio border-color rgb1383
padding-left 15pximportant screen-md3
wrapper2 padding-right 25pximportant3
plp-fieldcheckbox-list span vertical-align3
1 transform scale053
radiobefore opacity 13
inputchecked radiobefore opacity3
radio border-color rgb133
inputchecked radio border-color3
radio box-shadow inset3
inputactive radio box-shadow3
documentbodyclientwidth 992 documentbodyclientwidth3
wrapper1 wrapper2130
wrapper2 padding-top111
wrapper1 color104
color rgb2587
padding-right 5px80
5px padding-bottom80
padding-left 5px79
color fff71
5px padding-right66
padding-top 5px66
padding-bottom 5px59
5px padding-left59
rgb25 10855
108 23055
color 33349
vertical-align middle42
opacity 042
0 040
position absolute39
rgb255 25538
s-elements-gridcellwrapper padding-top37
255 25531
width 10030
display inline-block27
padding-top 0px27
0px padding-right27
padding-bottom 0px27
0px padding-left27
rgba0 025
overflow hidden24
position relative24
102 24122
color rgb23021
0 opacity21
input position21
0 height21
rgb230 2521
cursor pointer21
inline-block vertical-align21
bgimage tick21
25 2521
padding-right 0important20
0important padding-right20
padding-left 0px20
0px padding-bottom20
padding-right 0px20
padding-left 0important20
word-wrap break-word18
height 018
width 018
absolute width18
0 width18
text-align center18
0 padding-right17
rgb25 11017
padding-right 017
110 23017
padding-left 017
100important padding-left17
width 100important17
background-position center16
padding-right 15pximportant16
node148meta plp-fieldcheckbox-visual16
node144meta plp-fieldcheckbox-visual16
node145meta plp-fieldcheckbox-visual16
padding-left 15pximportant16
padding height16
node145meta plp-fieldradio-visual15
0 02515
svg opacity15
opacity 115
background-size cover15
display flex15
node148meta plp-fieldradio-visual15
absolute left15
left 015
top 015
height 10015
opacity 0515
node144meta plp-fieldradio-visual15
fill none14
width 5014
50 padding-left14
0important screen-xs13
fa font-size13
100 height12
background-color rgba4112
rgba41 8312
83 14512
span vertical-align12
300ms all12
transition 300ms12
0 overflow12
color rgb22512
rgb225 2512
25 23012
rgba22 10212
tick svg12
screen-xs node2912
transition all12
all 300ms12
inputchecked bgimage12
30px padding-bottom12
else if11
padding-left 15px10
wrapper2 background-color10
padding-right 15px10
30px border-radius10
border-radius 6px10
padding-left 30px10
fff border-radius10
padding-right 30px10
15pximportant padding-right10
15pximportant screen-xs10
center center10
center background-size10
15px padding-right10
rgb22 10210
wrapper1 background-position10
text-align right9
line-height 09
margin 09
wrapper2 padding-right9
padding-right 25pximportant9
height 20px9
padding-left 25pximportant9
255 255box-shadow9
text-align left9
right text-align9
s-elements-gridcellcell-2 width9
s-elements-gridcellcell-1 s-elements-gridcellwrapper9
s-elements-gridcellcell-1 width9
font-size 809
s-elements-gridcellcell-0 width9
s-elements-gridcellcell-0 s-elements-gridcellwrapper9
s-elements-gridcellcell-2 s-elements-gridcellwrapper9
flex-grow 19
rgba10 209
1 min-width9
flex align-items9
align-items center9
100 opacity9
cover background-repeat9
background-color rgba109
20 359
145 0border-color8
255 255stroke-width15stroke-linecaproundstroke-linejoinroundstroke-miterlimit108
if documentbodyclientwidth8
screen-xs node758
0pxborder-right-width 0pxborder-color8
112 181border-color8
node144meta plp-fieldresult8
node145meta plp-fieldresult8
screen-xs node918
0pxborder-left-width 0pxborder-right-width8
10px padding-bottom8
node148meta plp-fieldresult8
solidborder-top-width 0pxborder-bottom-width8
0pxborder-bottom-width 0pxborder-left-width8
node145meta plp-fieldfile7
node144meta plp-fieldfile7
168 2307
rgb25 1687
rect fill7
repeat color7
node148meta plp-fieldfile7
fill rgb2557
defs path7
path fill7
0px rgba07
rectfillnone fill7
background-repeat repeat7
white border6
border 2px6
2px solid6
solid rgba06
all border-radius6
top 506
50 transform6
025 position6
relative transition6
0 top6
transform translate-506
background white6
tick position6
20pximportant padding-left6
checkbox svg6
179 2486
background-color rgb226
223 background-color6
90 2236
rgb13 906
border-color rgb136
inputchecked checkbox6
rgb138 1796
svg width6
border-color rgb1386
translate-50 -506
checkbox border-color6
scale0 transition6
transform scale06
0 transform6
width 756
middle background6
middle padding-left6
75 display6
plp-fieldresult flexgridalign-right6
300ms opacity6
plp-fieldfile flexgrid6
0 transition6
plp-fieldresult flexgridalign-sides6
plp-fieldradio-visual bgimage6
plp-fieldresult flexgridalign-center6
left text-align6
300ms max-width6
50 top6
plp-fieldradio-visual item6
max-width 26px6
font-weight normal6
open sans6
font-family open6
font-size 14px6
26px position6
plp-fieldradio-visual tick6
display block6
inset 06
background-color rgba226
padding-left 56
auto display6
min-height auto6
100 background-color6
0 line-height6
55px 06
0 55px6
0 margin6
075 transition6
padding 06
height 22px6
22px height6
241 0756
width 22px6
5 margin-left6
margin-left -4px6
box-shadow inset6
5px rgba06
0 5px6
label position6
tick opacity6
margin-top 7333333333333333px6
label margin-top6
20px width6
plp-fieldcheckbox-visual inputchecked6
width 306
plp-fieldcheckbox-visual bgimage6
absolute top6
1 screen-xs6
bgimage background-size6
label label6
0 cursor6
hidden node144meta6
screen-xs node144meta6
item width6
0 left6
items display6
left 506
inputhover bgimage6
plp-fieldcheckbox-visual item6
break-word white-space6
item display6
justify-content space-between6
-20px justify-content6
margin-bottom -20px6
wrap margin-bottom6
plp-fieldradio-visual inputchecked6
margin-bottom 20px6
vertical-align top6
flex-wrap wrap6
flex flex-wrap6
top text-align6
0 word-wrap6
plp-fieldradio-visual subname6
center margin-bottom6
100 text-align6
cover display6
white-space normal6
padding-top 256
padding-top 1006
bgimage width6
0 node144meta6
border-radius 100px6
plp-fieldcheckbox-visual subname6
width 256
25 padding-top6
25 vertical-align6
white-space nowrap6
min-width 506
50 word-wrap6
plp-fieldcheckbox-visual tick6
1 transform6
middle screen-xs6
subname width6
0 0156
nowrap screen-xs6
subname margin6
inline-block background-position6
z-index 16
center border-radius6
left margin-bottom6
margin-bottom 10px6
10px white-space6
border-radius 50px6
pointer z-index6
50px overflow6
radio border-color6
100 padding-top6
plp-fieldselect-menu flexgrid6
flexgrid display6
7px 06
margin 7px6
center node144meta6
hidden position6
relative width6
screen-xs node1196
inherit cursor6
padding-bottom 20pximportant6
0 node145meta6
5px 0px6
20pximportant padding-bottom6
2px 5px6
0 node148meta6
0px 2px6
hidden node148meta6
40px padding-right6
129color rgb2556
center node145meta6
screen-xs node145meta6
hidden node145meta6
inset 0px6
241 056
0px rgba226
10px 0px6
4px 10px6
0px 4px6
255box-shadow 0px6
15pximportant padding-left6
color inherit6
dashed color6
5pxborder-style solidborder-top-width6
screen-xs node148meta6
center node148meta6
5pxborder-bottom-right-radius 5pxborder-bottom-left-radius6
padding-top 175px6
16px padding-left6
35 0566
056 padding-top6
padding-top 37px6
padding-top 40px6
37px padding-right6
padding-bottom 25px6
25px padding-left6
border-radius 3px6
wrapper1 background-color6
175px padding-bottom6
padding-top 30px6
padding-bottom 175px6
175px padding-left6
15px node296
s-elements-gridcellcell-3 width6
s-elements-gridcellcell-3 s-elements-gridcellwrapper6
height 80px6
padding-top 175pximportant6
175pximportant padding-bottom6
padding-bottom 175pximportant6
175pximportant padding-left6
5pxborder-bottom-left-radius 5pxborder-style6
padding-bottom 16px6
text-decoration none6
documentbodyclientwidth 9926
5pxborder-top-right-radius 5pxborder-bottom-right-radius6
padding-top 20pximportant6
none border-bottom-width6
screen-sm node1196
border-bottom-style dashed6
1px border-bottom-style6
201border-top-left-radius 5pxborder-top-right-radius6
node119 s-elements-gridcellcell-26
25pximportant padding-right6
border-bottom-width 1px6
node119 s-elements-gridcellcell-16
node119 s-elements-gridcellcell-06
middle node145meta5
node126 wrapper15
background-color rgb375
st0fillnonestrokergb255 2555
rgb25 1005
background-color rgb385
0px node915
100 2305
padding-bottom 10px5
10px padding-left5
25px padding-right5
rgb38 1125
border-width 2px5
if plpscreens5
0 node295
161padding-top 8pxpadding-bottom5
node130 wrapper15
8pxpadding-bottom 8pxpadding-left5
middle node148meta5
rgb37 1125
middle node144meta5
node134 wrapper15
node75 s-elements-gridcellcell-04
border-style solid4
solid border-color4
node75 s-elements-gridcellcell-34
node75 s-elements-gridcellcell-24
5pxpadding-left 10pxpadding-right4
node148meta plp-fieldselect-menu4
border-color rgb2554
10pxpadding-right 10pxfont-size4
30px padding-right4
padding-bottom 30px4
30px padding-left4
node75 s-elements-gridcellcell-14
15px node754
padding-top 10px4
0pxborder-color rgb364
2px border-style4
0pxborder-bottom-right-radius 0pxborder-bottom-left-radius4
25pximportant screen-xs4
background-color rgba454
node144meta plp-fieldprivacy-checkbox4
rgba45 924
92 1614
161 0border-top-left-radius4
background-color white4
s-elements-grid margin-left4
node29 s-elements-gridcellcell-04
0border-top-left-radius 0pxborder-top-right-radius4
0pxborder-top-right-radius 0pxborder-bottom-right-radius4
node29 s-elements-gridcellcell-14
8px border-width4
node29 s-elements-gridcellcell-24
node29 s-elements-gridcellcell-34
0pxborder-bottom-left-radius 0pxborder-style4
0pxborder-style solidborder-top-width4
node29 s-elements-gridcellcell-44
node29 s-elements-gridcellcell-54
10pximportant padding-bottom4
rgb36 744
74 129padding-top4
129padding-top 5pxpadding-bottom4
5pxpadding-bottom 5pxpadding-left4
border-radius 8px4
padding-top 10pximportant4
0pximportant screen-xs4
padding-bottom 10pximportant4
node145meta inputchecked4
10pximportant padding-left4
59 103color4
padding-bottom 0pximportant4
0pximportant padding-left4
node148meta plp-fieldprivacy-checkbox4
padding-bottom 20px4
20px padding-left4
padding-bottom 13px4
0border-color rgb324
node145meta plp-fieldselect-menu4
rgb32 664
66 116color4
pointer node145meta4
rgb29 594
padding-left 10px4
padding-right 10px4
145 04
border-radius 5px4
plpscreen md4
md else4
pointer node144meta4
documentbodyclientwidth 7684
plpscreen lg4
lg else4
node144meta plp-fieldselect-menu4
border-color rgb224
padding-top 0pximportant4
0pximportant padding-bottom4
padding-right 0pximportant4
background-color rgb2454
padding-bottom 22px4
22px padding-left4
0border-color rgb294
padding-left 25px4
node148meta inputchecked4
background-color rgb334
145color rgb2554
163border-color rgb304
rgb33 1004
0pximportant padding-right4
node145meta plp-fieldprivacy-checkbox4
pointer node148meta4
rgb245 2454
rgb34 1014
padding-left 0pximportant4
245 2454
node91 s-elements-gridcellcell-34
node144meta inputchecked4
245 color4
node91 s-elements-gridcellcell-04
node91 s-elements-gridcellcell-24
background-color rgb344
node91 s-elements-gridcellcell-14
plp-fieldradio-visual label3
1 node148meta3
1200 plpscreen3
plp-fieldradio-visual input3
containersoft max-width3
992 plpscreen3
documentbodyclientwidth 12003
768 documentbodyclientwidth3
plp-fieldselect-menu select3
container width3
plp-fieldradio-visual inputhover3
left flex-grow3
select position3
flexgridalign-sides display3
flexgridalign-right left3
flexgridalign-center left3
margin-bottom 03
name margin-bottom3
left name3
flexgridalign-sides left3
center flex-grow3
plp-fieldresult flexgrid3
flexgrid center3
cleanhover opacity3
plp-fieldfile cleanhover3
relative z-index3
pointer position3
05 cursor3
right opacity3
middle text-decoration3
flexgrid right3
clean float3
plp-fieldprivacy-button open3
80 cursor3
05 font-size3
center opacity3
plp-fieldprivacy-checkbox font-size3
plp-fieldprivacy-checkbox span3
open text-align3
flexgridalign-right right3
right flex-grow3
flexgridalign-center right3
flexgridalign-left right3
plp-fieldresult flexgridalign-left3
right font-size3
break-word text-align3
25 word-wrap3
min-width 253
float right3
plp-fieldfile clean3
node148meta plp-fieldradio-list3
flexgrid left3
20px height3
width 20px3
plp-fieldfile svg3
node148meta plp-fieldcheckbox-list3
100 node148meta3
tick node148meta3
05 vertical-align3
middle margin-top3
20px line-height3
font-size 20px3
plp-fieldselect-menu fa3
-webkit-appearance none3
black -webkit-appearance3
color black3
1 color3
20px vertical-align3
1 node145meta3
z-index 03
plp-fieldprivacy-checkbox input3
plp-fieldfile input3
1 node144meta3
line-height 13
middle line-height3
span display3
plp-fieldfile span3
margin-bottom -5px3
plp-fieldprivacy-text font-size3
node145meta plp-fieldradio-list3
-5px margin-bottom3
80 text-align3
plp-fieldhidden opacity3
opacity 0253
margin-top -5px3
node145meta plp-fieldcheckbox-list3
tick node145meta3
plp-fieldradio-visual items3
label font-weight3
plp-fieldradio-visual overflow3
36px padding-right3
15pximportant screen-sm3
50px screen-xs3
padding-left 50px3
39px padding-left3
padding-bottom 39px3
50px padding-bottom3
padding-right 50px3
padding-top 36px3
25pximportant padding-left3
247 0133
163 2473
rgba115 1633
0px rgba1153
17px 0px3
15px 17px3
0px 15px3
15pximportant screen-md3
width 333333333333333363
333 box-shadow3
14px font-size3
margin-bottom 65px3
08 margin-bottom3
opacity 083
sans opacity3
normal font-family3
name font-weight3
14px font-family3
padding-bottom 14px3
33333333333333336 padding-left3
plp-field padding-bottom3
0important screen-sm3
50important padding-left3
width 50important3
25px node1193
padding-right 25px3
20px padding-bottom3
padding-top 20px3
box-shadow 0px3
255 color3
font-size 13px3
24pxpadding-right 24pxfont-size3
rgb30 903
80 129color3
rgb27 803
181border-color rgb273
uppercasecolor rgb2553
text-transform uppercasecolor3
01em text-transform3
8pxpadding-left 24pxpadding-right3
255box-shadow inset3
100 161padding-top3
rgb34 1003
125 201border-top-left-radius3
rgb42 1253
background-color rgb423
node9 wrapper13
182 2453
rgb41 1823
font-size 23px3
background-repeat no-repeat3
background-color rgb2553
rgb26 793
13px padding-left3
103 2303
rgb25 1033
0 node913
rgb0 03
rgb30 893
79 129color3
181border-color rgb263
no-repeat color3
99 161padding-top3
rgb33 993
124 201border-top-left-radius3
rgb41 1243
background-color rgb413
0 node753
0 screen-xs3
padding-bottom 17px3
65px font-size3
13px word-wrap3
plp-fieldradio-list label3
content display3
radio box-shadow3
inputactive radio3
inputfocus radio3
inputhover radio3
100px opacity3
white border-radius3
block background-color3
100 content3
inputchecked radiobefore3
100 top3
radiobefore position3
22px min-height3
0 padding3
radio margin3
transform scale13
checkbox box-shadow3
inputactive checkbox3
inputchecked radio3
radiobefore opacity3
inputhover checkbox3
tick node144meta3
plp-fieldradio-list input3
plp-fieldradio-list span3
node144meta plp-fieldradio-list3
plp-fieldcheckbox-input input3
plp-fieldcheckbox-input span3
inputfocus bgimage3
plp-fieldcheckbox-visual inputfocus3
plp-fieldcheckbox-visual inputhover3
transform scale053
plp-fieldcheckbox-visual input3
plp-fieldcheckbox-visual label3
plp-fieldcheckbox-visual items3
plp-fieldcheckbox-visual overflow3
plp-fieldcheckbox-list label3
plp-fieldcheckbox-list input3
plp-fieldcheckbox-list span3
node144meta plp-fieldcheckbox-list3
inputfocus checkbox3
border-radius 2px3
break-word text-transform3
none position3
none rgba03
1px none3
border 1px3
05 border3
0 053
color rgba03
relative background-color3
box-shadow none3
5px padding3
12 box-shadow3
line-height 123
auto line-height3
height auto3
form-control height3
letter-spacing 01em3
uppercase letter-spacing3
text-transform uppercase3
025 border-radius3
padding 12px3
0 min-height3
form-control margin-top3
22px padding3
checkbox width3
resize vertical3
textarea resize3
block cursor3
normal display3
margin-top 10px3
form-control form-control3
12px 96px3
242 2423
rgb242 2423
background-color rgb2423
241 background-color3
form-controlfocus-within border-color3
cursor initial3
14px cursor3
96px font-size3
992 documentbodyclientwidth3
5px300
0263
color252
wrapper1250
padding-left202
padding-right196
padding-top170
padding-bottom160
wrapper2130
0px129
width115
199
node145meta88
node148meta88
node144meta88
rgb2587
279
background-color78
opacity78
fff71
369
464
position63
height61
screen-xs56
center56
555
649
vertical-align48
plp-fieldcheckbox-visual48
display48
plp-fieldradio-visual45
left42
middle42
0important40
absolute39
border-radius39
rgb25538
s-elements-gridcellwrapper37
text-align36
font-size34
bgimage33
733
tick33
10px32
832
15pximportant32
none30
30px30
20px29
node2928
margin-bottom27
top27
inline-block27
padding26
0525
rgba025
inputchecked24
15px24
plp-fieldresult24
all24
300ms24
transition24
relative24
right24
overflow24
cursor24
hidden24
923
node11922
1022
rgb23021
checkbox21
pointer21
svg21
label21
plp-fieldfile21
input21
fill21
node7520
2px20
border-color20
node9120
s-elements-gridcellcell-118
break-word18
s-elements-gridcellcell-218
02518
word-wrap18
s-elements-gridcellcell-018
25pximportant18
transform18
1117
100important17
25px17
22px16
0pximportant16
background-position16
background-size16
flex15
margin15
span15
flexgrid15
line-height15
radio15
cover15
path14
if14
documentbodyclientwidth14
box-shadow13
fa13
1213
50px13
inputhover12
20pximportant12
plp-fieldselect-menu12
item12
175px12
1312
1412
175pximportant12
plp-fieldprivacy-checkbox12
margin-top12
s-elements-gridcellcell-312
svg2012
inset12
min-width12
else12
white-space12
rgba4112
subname12
normal12
rgb22512
rgba2212
svg2311
1511
plpscreen11
svg2110
6px10
rgb2210
margin-left10
auto10
1610
svg610
svg2210
solid10
solidborder-top-width10
max-width10
1710
svg710
background-repeat10
svg810
white10
flex-grow9
14px9
align-items9
open9
plp-fieldradio-list9
1px9
255box-shadow9
189
inputfocus9
z-index9
rgba109
form-control9
plp-fieldcheckbox-list9
199
screen-sm9
border9
0pxborder-right-width8
0pxborder-left-width8
0border-color8
0pxborder-bottom-width8
10pximportant8
255stroke-width15stroke-linecaproundstroke-linejoinroundstroke-miterlimit108
181border-color8
0pxborder-color8
rgb347
13px7
207
polygon7
rect7
defs7
pathfillnone7
repeat7
16px7
40px7
circlefillnone7
polygonfillnone7
rgb337
rectfillnone7
217
circle7
rgb136
7333333333333333px6
55px6
min-height6
background6
scale06
rgb1386
226
plp-fieldcheckbox-input6
7px6
236
name6
items6
node1306
flex-wrap6
wrap6
-20px6
justify-content6
space-between6
node1266
font-family6
0756
sans6
26px6
font-weight6
inputactive6
translate-506
246
node1346
nowrap6
256
radiobefore6
100px6
0156
266
276
-4px6
block6
286
inherit6
-5px6
296
201border-top-left-radius6
3px6
37px6
0566
rgb416
80px6
17px6
306
rgb306
dashed6
129color6
4px6
text-transform6
01em6
161padding-top6
5pxborder-style6
5pxborder-bottom-left-radius6
5pxborder-bottom-right-radius6
plp-fieldprivacy-text6
5pxborder-top-right-radius6
border-bottom-style6
flexgridalign-sides6
flexgridalign-right6
text-decoration6
border-bottom-width6
flexgridalign-center6
8pxpadding-left5
border-style5
rgb375
rgb385
st0fillnonestrokergb2555
plpscreens5
border-width5
8pxpadding-bottom5
node244
314
rgb324
31px4
324
container4
334
node1404
116color4
node774
node94
36px4
node114
344
145color4
163border-color4
354
lg4
md4
8px4
rgba454
103color4
0border-top-left-radius4
364
node494
s-elements-gridcellcell-54
s-elements-gridcellcell-44
margin-right4
-15px4
s-elements-grid4
node624
node1034
node574
0pxborder-bottom-left-radius4
0pxborder-style4
rgb2454
node534
rgb364
374
129padding-top4
rgb294
5pxpadding-bottom4
node374
0pxborder-top-right-radius4
0pxborder-bottom-right-radius4
underlinecolor4
node944
node684
node964
10pxfont-size4
10pxpadding-right4
node1504
node454
5pxpadding-left4
node414
scale13
383
cookie3
1170px3
content3
plp-fieldhidden3
node1413
node1433
node1483
node1463
node1453
node1443
select3
node1533
plp-fieldprivacy-button3
black3
-webkit-appearance3
flexgridalign-left3
cleanhover3
float3
node1523
node1543
scale053
divareascreen-lg3
750px3
divareascreen-sm3
970px3
divareascreen-md3
containersoft3
clean3
node1883
node1563
node1873
node1383
node1513
node1593
node1573
node1553
node23
node1123
vertical3
node593
node403
node463
node473
node443
node503
node513
node483
node543
node553
node523
node583
node563
node423
node613
node643
node633
node693
node603
node763
node783
node843
node833
node863
node853
node883
node433
node363
node903
node123
node33
393
node43
node13
node103
rgb423
403
24pxpadding-right3
24pxfont-size3
uppercasecolor3
rgb273
23px3
node153
node393
node163
node173
node183
node193
node203
node143
node03
no-repeat3
35px3
node303
node313
node383
node873
node893
resize3
node1423
39px3
screen-md3
node1313
node1323
node1333
node1353
node1363
node1373
413
50important3
node1393
plp-field3
423
083
65px3
uppercase3
letter-spacing3
433
12px3
96px3
initial3
form-controlfocus3
form-controlfocus-within3
rgb2423
textarea3
0133
rgba1153
node923
rgb263
node933
node1113
node1143
node1133
node1163
node1153
node1183
node1173
node953
node983
443
453
463
node1293
473
node993
node1013
node1023
rgb03
node1043
node973
node1203
483
node1213
node1273
node1283
f3

Who hosts Cleanin-grad.ru?

Cleanin-grad.ru Hosting Provider Information

Hosted IP Address:85.119.149.99
Hosted Hostname:85.119.149.99
Service Provider:Academinform JSC
Hosted Country:RussiaRU
Location Latitude:55.7386
Location Longitude:37.6068
Webserver Software:openresty

Is "Academinform JSC" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
Academinform JSC
0.0086%

HTTP Header Analysis for Cleanin-grad.ru

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: openresty
Date: Sat, 28 Nov 2020 14:33:02 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=20
Content-encoding: gzip

Cleanin-grad.ru Domain Nameserver Information

HostIP AddressCountry
ns1.platformalp.ru 185.206.180.110
ns2.platformalp.ru 158.255.1.229


Need to find out who hosts Cleanin-grad.ru?


Domain Registration (WhoIs) information for Cleanin-grad.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: CLEANIN-GRAD.RU
nserver: ns1.platformalp.ru.
nserver: ns2.platformalp.ru.
state: REGISTERED, DELEGATED, VERIFIED
person: Private Person
registrar: R01-RU
admin-contact: https://partner.r01.ru/contact_admin.khtml
created: 2019-09-04T16:30:35Z
paid-till: 2021-09-04T16:30:35Z
free-date: 2021-10-05
source: TCI

Last updated on 2020-11-28T14:31:30Z

Websites with Similar Names

Clean-21.com
Clean21 Dhaka (21 word)Dhaka South Sity Corporation-DSCC
Clean-2day.com
Clean2Day – Cleaning Services
Clean-55.ru
Чистка ковров на дому в Омске
Clean-9-detox.de
ᑕ❶ᑐ Clean 9 – Offizieller Erfahrungsbericht - Clean 9 kaufen oder nicht?
Clean-9-reinigung.de
ᑕ❶ᑐ Clean 9 – Offizieller Erfahrungsbericht - Clean 9 kaufen oder nicht?
Clean-99.com
家事清潔用品館 | 地板清潔,廚房清潔,好用拖把,居家用品,環保清潔劑,天然清潔劑,黏毛器,掃把畚斗,畚箕,馬桶刷,衛浴清潔,衛生清潔,衣物清潔,家電清潔,3C清潔,掃把,手套,拖把桿,掃把畚箕組,地毯踏墊

Recently Updated Websites

Parouteau-menuiseries.com (1 second ago.)Njpartyballoons.com (2 seconds ago.)Novalawfirms.com (2 seconds ago.)Mrx-on-demand.com (2 seconds ago.)Manufacture-usa-academy.com (2 seconds ago.)Paintimprovement.com (2 seconds ago.)Madeandtold.com (2 seconds ago.)Nurturingjoyconsulting.com (3 seconds ago.)Oj6bncso.com (3 seconds ago.)Ornament-pass.com (3 seconds ago.)Optimal-ev.com (3 seconds ago.)Osakatsurumi-naika.com (4 seconds ago.)Masterpeaceministries.com (4 seconds ago.)Meubebeemcasa.com (4 seconds ago.)Myfabulousdomains.com (4 seconds ago.)Oksignsokdesigns.com (4 seconds ago.)Muirex.com (4 seconds ago.)Osimcos.com (4 seconds ago.)Myoceanhouse.com (4 seconds ago.)Paltrees.com (5 seconds ago.)Mpay606.com (5 seconds ago.)Myvegaspoint.com (5 seconds ago.)Lumicleanse.com (5 seconds ago.)Newkindawomansalon.com (5 seconds ago.)Partutech.com (6 seconds ago.)Modeviasanitizer.com (6 seconds ago.)Patentpendingservice.com (6 seconds ago.)Onyoursidetutoring.com (6 seconds ago.)Myduradog.com (6 seconds ago.)Omerajoy.com (6 seconds ago.)

Recently Searched Keywords

you will find (1 second ago.)bioactive styling (3 seconds ago.)localedata translationslocaledata domain (5 seconds ago.)kurierzy (5 seconds ago.)contractubex (11 seconds ago.)外貌清纯的妹子其实淫荡的很,被按摩棒一震就失声淫叫 (12 seconds ago.)os resultados (16 seconds ago.)運営ポリシー (16 seconds ago.)movie review poor (20 seconds ago.)alpharetta annulment attorneys (21 seconds ago.)ð”ð¸ð²ð°ð½ñ‹ ð•ð²ñ€ð¾ðºð½ð¸ð¶ðºð¸ (24 seconds ago.)asesora (24 seconds ago.)gformbody (26 seconds ago.)facebook ad (28 seconds ago.)teste de velocidade (38 seconds ago.)name domain (39 seconds ago.)pertama yang (49 seconds ago.)wodelayfunction value (1 minute 6 seconds ago.)wodelayfunction (1 minute 7 seconds ago.)人生 (1 minute 8 seconds ago.)2nd edition (1 minute 10 seconds ago.)about bo (1 minute 12 seconds ago.)airblue (1 minute 14 seconds ago.)scienceratio100optionfilm studiesratio100optionfinanceratio100optiongeographyratio100optiongeologyratio100optionhistoryratio100optionhuman resource (1 minute 15 seconds ago.)sederet (1 minute 15 seconds ago.)tables (1 minute 16 seconds ago.)text src (1 minute 17 seconds ago.)scienceratio100optionfilm studiesratio100optionfinanceratio100optiongeographyratio100optiongeologyratio100optionhistoryratio100optionhuman resource (1 minute 18 seconds ago.)reparaturen (1 minute 20 seconds ago.)windows (1 minute 21 seconds ago.)