Clickutility on Earth - Consulenza mobilità sostenibile, trasporti, automotive, sharing

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-19
Category: This site has not been categorized yet

HUB di consulenza internazionale per cogliere i cambiamenti nel mondo nell’automotive, dei servizi di mobilità e delle nuove tecnologie.


Domain summary

Domain label
clickutilityonearth
Domain extension
it
Domain registered:
2020-10-19
Domain updated:
2020-10-19
Domain expires:
2021-03-25
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is clickutilityonearth.it ranked relative to other sites:

Percentage of visits to clickutilityonearth.it from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Clickutilityonearth.it registered?
A: Clickutilityonearth.it was registered 3 months, 1 week, 14 hours, 11 minutes, 35 seconds ago on Monday, October 19, 2020.
Q: When was the WHOIS for Clickutilityonearth.it last updated?
A: The WHOIS entry was last updated 3 months, 1 week, 14 hours, 11 minutes, 35 seconds ago on Monday, October 19, 2020.
Q: What are Clickutilityonearth.it's nameservers?
A: DNS for Clickutilityonearth.it is provided by the following nameservers:
  • ns1.drnameservice.com
  • ns2.drnameservice.com
  • ns3.drnameservice.com
Q: Who is the registrar for the Clickutilityonearth.it domain?
A: The domain has been registered at IT-Nic.
Q: What is the traffic rank for Clickutilityonearth.it?
A: Clickutilityonearth.it has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Clickutilityonearth.it each day?
A: Clickutilityonearth.it receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Clickutilityonearth.it resolve to?
A: Clickutilityonearth.it resolves to the IPv4 address 5.144.160.87.
Q: In what country are Clickutilityonearth.it servers located in?
A: Clickutilityonearth.it has servers located in the Italy.
Q: What webserver software does Clickutilityonearth.it use?
A: Clickutilityonearth.it is powered by Nginx webserver.
Q: Who hosts Clickutilityonearth.it?
A: Clickutilityonearth.it is hosted by Seeweb s.r.l. in Italy.
Q: How much is Clickutilityonearth.it worth?
A: Clickutilityonearth.it has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Clickutilityonearth.it Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Clickutilityonearth.it Free SEO Report

Website Inpage Analysis for Clickutilityonearth.it

H1 Headings

2 :
  1. We also use third-party cookies to allow the best experience on the site
  2. Clickutility on Earth

H2 Headings

6 :
  1. Sharing & New Mobility
  2. Parking & Public Transport
  3. Electric Vehicle Business
  4. Automotive
  5. Costruiamo insieme la mobilità del futuro!
  6. Hub di competenze per la guida autonoma

H3 Headings

0 :

H4 Headings

31 :
  1. HUB di consulenza internazionale per cogliere i cambiamenti nel mondo nell’automotive, dei servizi di mobilità e delle nuove tecnologie
  2. LE NOSTRE INIZIATIVE
  3. Cases
  4. Clients
  5. Dicono di noi
  6. SHARE NOW sceglie Clickutility on Earth come Agenzia PR in Italia
  7. SHARE NOW sceglie Clickutility on Earth come Agenzia PR in Italia
  8. SHARE NOW sceglie Clickutility on Earth come Agenzia PR in Italia
  9. Come la smart city elettrica del futuro cambierà la mobilità
  10. La mobilità elettrica pronta a partire
  11. Guida autonoma, quale futuro
  12. Auto sempre più connesse e condivise?
  13. Mobilità sostenibile, lo scooter elettrico soluzione ideale per la città
  14. Waze: più sicurezza per gli automobilisti e le flotte aziendali
  15. Bosch e la guida autonoma: perchè è importante il concetto di ridondanza?
  16. Citytech: Carabelli, Arexpo, il progetto Mind, un ecosistema dell’innovazione
  17. Citytech 2018, Porro: Pirelli torna al primo amore, le gomme per le bici
  18. Citytech 2018, Caleno di Enel X: mancano regole comuni per l’elettrificazione
  19. Citytech, Olivi di BMW Italia: i nostri 4 pilastri di mobilità sostenibile
  20. Citytech 2018, mobilità sostenibile: il future è oggi
  21. Nel quartiere UpTown arriva il roboshuttle elettrico a guida autonoma
  22. Cobianchi, Bosch, Citytech: l’auto sarà più condivisa e meno di proprietà
  23. A Citytech 2018 si rimodella la mobilità urbana
  24. Citytech 2018: a Milano focus sulla nuova mobilità urbana
  25. Donne e motori: chi sono le manager automotive più influenti in Italia
  26. Bologna
  27. Milano
  28. Email
  29. Facebook
  30. Twitter
  31. Clickutility on Earth

H5 Headings

9 :
  1. Quisque
  2. hive
  3. Kids Park
  4. FREE NOW (ex mytaxi)
  5. VINCO.NET
  6. Energica
  7. Automotive Dealer Day
  8. Spin8
  9. SHARE NOW (car2go&DriveNow)

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

113 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-38529561-1

Links - Internal

23:

Links - Internal (nofollow)

0:

Links - Outbound

26:

Links - Outbound (nofollow)

0:

Keyword Cloud for Clickutilityonearth.it

aiutiamodimobilitmobilityhtmldivinnerhtmlbolognanuovieeucookielawhtmlfragmentsilhtmldivcssvar

Longtail Keyword Density for Clickutilityonearth.it

KeywordsOccurences
e8
var7
di6
mobilit6
il4
eucookielawhtmlfragments4
mobility3
nuovi3
aiutiamo3
htmldivcss3
htmldivinnerhtml3
bologna3

Who hosts Clickutilityonearth.it?

Clickutilityonearth.it Hosting Provider Information

Hosted IP Address:5.144.160.87
Hosted Hostname:sdsm06n01.24-7-network.com
Service Provider:Seeweb s.r.l.
Hosted Country:ItalyIT
Location Latitude:43.1479
Location Longitude:12.1097
Webserver Software:nginx

Is "Seeweb s.r.l." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
Seeweb s.r.l.
0.0209%

HTTP Header Analysis for Clickutilityonearth.it

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Mon, 19 Oct 2020 04:02:12 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 16777
Connection: keep-alive
Link:; rel="https://api.w.org/", ; rel=shortlink
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip

Clickutilityonearth.it Domain Nameserver Information

HostIP AddressCountry
ns1.drnameservice.com 91.223.115.55
ns2.drnameservice.com 139.162.188.167
ns3.drnameservice.com 45.33.126.176


Need to find out who hosts Clickutilityonearth.it?


Domain Registration (WhoIs) information for Clickutilityonearth.it

 *********************************************************************
* Please note that the following result could be a subgroup of *
* the data contained in the database. *
* *
* Additional information can be visualized at: *
* http://web-whois.nic.it *
* Privacy Information: http://web-whois.nic.it/privacy *
*********************************************************************

Domain: clickutilityonearth.it
Status: ok
Signed: no
Created: 2012-12-15 18:00:16
Last Update: 2020-04-10 00:48:04
Expire Date: 2021-03-25

Registrant
Organization: CLICK UTILITY ON EARTH SRL

Admin Contact
Name: hidden
Organization: hidden

Technical Contacts
Name: hidden
Organization: hidden

Registrar
Organization: PERSOLVO d.o.o.
Name: DR-REG
Web: http://www.domainregister.it
DNSSEC: no

Nameservers
ns1.drnameservice.com
ns2.drnameservice.com
ns3.drnameservice.com

Websites with Similar Names

Click------go.com
????? ???? ???? ??????????
Click-----go.com
????? ???? ???? ??????????
Click----and----go.com
????? ???? ???? ??????????
Click----and---go.com
????? ???? ???? ??????????
Click----on----go.com
????? ???? ???? ??????????
Click----on---go.com
????? ???? ???? ??????????
Click----to----go.com
????? ???? ???? ??????????
Click---and---go.com
????? ???? ???? ??????????
Click---on---go.com
????? ???? ???? ??????????
Click---on--me.com
????? ???? ???? ??????????

Recently Updated Websites

Moczekbau.com (2 seconds ago.)Momentaryspillage.com (3 seconds ago.)Mollyaliceminx.com (4 seconds ago.)Kepezcambalkon.com (4 seconds ago.)Istanat.com (7 seconds ago.)Mingsmc.com (8 seconds ago.)Aeropostalee.com (14 seconds ago.)Marshesteps.com (17 seconds ago.)Klkl-shop.com (17 seconds ago.)Levaka.com (20 seconds ago.)Masukwifi.com (23 seconds ago.)Mybcandt.com (23 seconds ago.)Monumentalhomestexas.com (25 seconds ago.)Kip760.com (26 seconds ago.)Lowerriveroutdoors.com (27 seconds ago.)Maskcorpdefense.com (27 seconds ago.)Kmthealthcare.com (28 seconds ago.)Layoffweed.com (29 seconds ago.)Liveatgmg.com (30 seconds ago.)Lauraarchermsw.com (31 seconds ago.)Metakonrt.com (32 seconds ago.)Mirrinowool.com (33 seconds ago.)Madshisha.com (33 seconds ago.)Ligadelainnovacion.com (34 seconds ago.)Mothersgravepod.com (35 seconds ago.)Kritbuddhi.com (35 seconds ago.)Larkandgraceinteriors.com (35 seconds ago.)Meatbaaz.com (36 seconds ago.)Married2medicare.com (36 seconds ago.)Mothers-againstracism.com (39 seconds ago.)

Recently Searched Keywords

history learning site tudors (1 second ago.)products-groups divdata-grouplength (3 seconds ago.)city treehouse price (4 seconds ago.)mobile forms (5 seconds ago.)舞蹈教学 (6 seconds ago.)fall meeting supporters (11 seconds ago.)defqueueislohp defqueueislohp (11 seconds ago.)mentions l�gales rgpd (15 seconds ago.)group he (21 seconds ago.)all skin needs (23 seconds ago.)check out our portfolio (23 seconds ago.)bancassurance portal (25 seconds ago.)ecommerce platforms (26 seconds ago.)acer 24 (29 seconds ago.)ワンピースは何編が好きですか? 0 コメント | 34 view (30 seconds ago.)nurseworksnorthwest (37 seconds ago.)zakład pogrzebowy bytom teksty (39 seconds ago.)effective synonym (40 seconds ago.)reset package (40 seconds ago.)【中和區】中和環球倉庫(近中和環球購物中心)【新開幕!】 (50 seconds ago.)actrece (52 seconds ago.)blnmb (53 seconds ago.)21 способ seo оптимизации вашего блога (55 seconds ago.)barberis bordeaux windowpane (57 seconds ago.)tác dụng tuyệt vời của tổ yến loại 1 mang lại sức khỏe – chia sẻ từ yến sào việt phúc (57 seconds ago.)fat navel (57 seconds ago.)try the app (58 seconds ago.)listcralwer (1 minute ago.)فرارسانه (1 minute 3 seconds ago.)golf mlaga (1 minute 3 seconds ago.)