Climea forte | Menopauza lżejsza niż myślisz

Safety: Low trust score
Year Founded: 2004
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2021-12-07
Domain label
climea
Domain extension
pl
Domain registered:
2004-11-30
Domain updated:
2021-10-26
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Climea.pl registered?
A: Climea.pl was registered 17 years, 1 month, 3 weeks, 2 days, 16 hours, 25 minutes, 53 seconds ago on Tuesday, November 30, 2004.
Q: When was the WHOIS for Climea.pl last updated?
A: The WHOIS entry was last updated 2 months, 4 weeks, 16 hours, 25 minutes, 53 seconds ago on Tuesday, October 26, 2021.
Q: What are Climea.pl's nameservers?
A: DNS for Climea.pl is provided by the following nameservers:
  • dns.aflofarm.pl
  • ns.tpnet.pl
Q: Who is the registrar for the Climea.pl domain?
A: The domain has been registered at NASK.
Q: What is the traffic rank for Climea.pl?
A: Climea.pl has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Climea.pl each day?
A: Climea.pl receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Climea.pl resolve to?
A: Climea.pl resolves to the IPv4 address 212.160.230.212.
Q: In what country are Climea.pl servers located in?
A: Climea.pl has servers located in the Poland.
Q: What webserver software does Climea.pl use?
A: Climea.pl is powered by Apache/2.4.41 (Fedora) OpenSSL/1.1.1g webserver.
Q: Who hosts Climea.pl?
A: Climea.pl is hosted by Orange Polska Spolka Akcyjna in Podlasie, Brzozowka Koronna, Poland, 16-020.
Q: How much is Climea.pl worth?
A: Climea.pl has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Climea.pl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Climea.pl Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Climea.pl

H1 Headings

10 :
  1. Menopauza lżejsza niż myślisz
  2. Menopauza
  3. W czasie menopauzy Climea forte
  4. Climea forte plus
  5. Climea forte – na objawy menopauzy
  6. Climea forte na objawy menopauzy + wsparcie zdrowia skóry, włosów i paznokci oraz prawidłowej pracy tarczycy
  7. Dlaczego Climea?
  8. Czy wiesz że...
  9. Czy to już menopauza?
  10. Polityka plików cookies

H2 Headings

4 :
  1. Climea forte i Climea forte plus – bogate źródło witaminy D
  2. Test - Czy to już menopauza?
  3. Regulamin
  4. Polityka prywatności

H3 Headings

13 :
  1. od około35 r.ż.premenopauza
  2. od około35-40 r.ż.perimenopauza
  3. od około50 r.ż.postmenopauza
  4. od około65 r.ż.starość
  5. Wyciąg z szyszek chmielu1
  6. Wapń
  7. Nasiona lnu2
  8. Witamina E
  9. Witamina B6 i foliany w tym kwas foliowy3
  10. Witamina D
  11. Biotynę
  12. Jod i selen
  13. Witaminę A

H4 Headings

0 :

H5 Headings

1 :
  1. Polecamy również

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

25 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-24409824-1

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Climea.pl

mogwynikarozpoczyna si poclimea fortejak uderzenia gorcaostatecznie przestajustaflofarm farmacjaczaswpywaroku ycia oddziaanie wynikapo ostatniej miesiczcekobietydziaanie wynika z95200tejokres ktryprawidowe funkcjonowanietrwa onawszelkieprzegldarki internetowejselenostatniej miesiczce wfunkcjonowanie ukadudo ok 65aflofarm farmacja polskacookiesnieosbfunkcjonowaniepo ostatniejjajnikiostatniw tejust 1rozpoczynana podstawiemenopauziefarmacja polskatenprzezwacicielaartinternetowegouderzeniawspiera prawidoweochronyobjawy menopauzyswnbsptymdietyostatecznie przestaj funkcjonowadane osoboweestrogenwinteresfunkcjonowa jajniki trwajajniki trwa onamiesiczce wona do okzmianypluswaniepomagajinformacjitepowygasanie czynnociaflofarmfuzasadnionywitaminaona doanbsptakewnbspustawieniachfazieuzasadniony interesmajplikiprzetwarzanialubnanbspurzdzeniupolska sposobowejak uderzeniaprzeznbspuytkownikapliki cookiesfazie ostatecznieprawnie uzasadniony interesart 6inne0okres tenprzestaj funkcjonowawitaminymoeusuniciaukaduprywatnociodzgodtrecinastpuje wygasaniepomaga zachowatrwa ona doczystronaok 65 rokutej fazie ostatecznieprzedfarmacjapomagasidotyczcychserwisudladanedanych osobowychtej faziejedynie6 ust 11alemiesiczcekocowymktry rozpoczynawnbspkadym czasieonajajnikw1 litw produkcieust 1 litskrostatniejsuprzeznbspaflofarmmenopauzamenopauzyzpaznokciosobowychumowyokbdziejajniki trwarokuczasiezmianw tej fazieczynnoci jajnikwinformacjeprawoichzbieraneplikwfunkcjonowawspierajspprawidowelitdo ok6 ustokres ktry rozpoczynawoswfunkcjonowanie ukadu odpornociowegodzachowaycia oddanychfarmacja polska sppolskaprawauytkownikprodukcieprzyzawierawwygasanie czynnoci jajnikwwygasaniecownbspkadymwspieraprawnie uzasadnionyfazie ostatecznie przestajlochronieukadu odpornociowegoclimeaplczynnociok 65ktreskry woswprawidowegomuderzenia gorcapolitykarejestrulatprzetwarzaneorganyfunkcjonowaniawnbspserwisiesi po ostatniejpodstawznbspdniaejodostatecznieforte plusdoclimea forte plustakichdziaaniarwniestronmiesiczkplikw cookiesyciaprawskadnikiskryclimeanastpujetymktre majprzestaj funkcjonowa jajnikiwynika zodpornociowegoktrybdw tymobjawwsi powikszonastpuje wygasanie czynnocirodostanowigorcaprawnietestroku yciazaogfunkcjonowaniuktry rozpoczyna siprzestajpolityka prywatnoci65 rokusesjiwspiera prawidowe funkcjonowaniefunkcjonowa jajnikijakpodprzechowywaneostatni miesiczksposb3serwisu internetowegookresprzepiswobsugidalejutrzymanieostatniej miesiczcetakemupodstawieinternetowejwpywstronyjeeliproduktwsobietrwananbspurzdzeniu kocowymwnbspokresierozpoczyna siobjawymiesiczce w tejdotyczceprawidowe funkcjonowanie ukaduoraztimesjelitegonaprawidowego funkcjonowaniaserwistarczycyforteprzegldarkijestwikszo objaww2dziaanieruytkownika65 roku yciadzikiosobarednioart 6 ust

Longtail Keyword Density for Climea.pl

KeywordsOccurences
climea forte plus7
ok 65 roku4
6 ust 14
art 6 ust4
farmacja polska sp4
65 roku ycia4
ust 1 lit4
si po ostatniej3
rozpoczyna si po3
wygasanie czynnoci jajnikw3
jak uderzenia gorca3
prawnie uzasadniony interes3
okres ktry rozpoczyna3
aflofarm farmacja polska3
dziaanie wynika z3
funkcjonowanie ukadu odpornociowego3
prawidowe funkcjonowanie ukadu3
wspiera prawidowe funkcjonowanie3
roku ycia od3
ktry rozpoczyna si3
do ok 653
po ostatniej miesiczce3
ona do ok3
trwa ona do3
nastpuje wygasanie czynnoci3
funkcjonowa jajniki trwa3
przestaj funkcjonowa jajniki3
ostatecznie przestaj funkcjonowa3
fazie ostatecznie przestaj3
tej fazie ostatecznie3
w tej fazie3
miesiczce w tej3
ostatniej miesiczce w3
jajniki trwa ona3
climea forte14
danych osobowych13
plikw cookies10
pliki cookies7
forte plus7
rozpoczyna si6
dane osobowe6
na podstawie5
prawidowe funkcjonowanie5
objawy menopauzy4
roku ycia4
65 roku4
ok 654
ukadu odpornociowego4
farmacja polska4
polska sp4
pomaga zachowa4
uderzenia gorca4
1 lit4
ust 14
6 ust4
art 64
wnbspkadym czasie4
serwisu internetowego3
wspiera prawidowe3
nanbspurzdzeniu kocowym3
uzasadniony interes3
funkcjonowanie ukadu3
prawnie uzasadniony3
dziaanie wynika3
wynika z3
w produkcie3
aflofarm farmacja3
polityka prywatnoci3
ycia od3
prawidowego funkcjonowania3
po ostatniej3
nastpuje wygasanie3
wygasanie czynnoci3
czynnoci jajnikw3
ostatni miesiczk3
okres ten3
w tym3
wikszo objaww3
jak uderzenia3
okres ktry3
ktry rozpoczyna3
si po3
ostatniej miesiczce3
ktre maj3
miesiczce w3
w tej3
tej fazie3
fazie ostatecznie3
ostatecznie przestaj3
przestaj funkcjonowa3
funkcjonowa jajniki3
jajniki trwa3
trwa ona3
ona do3
do ok3
skry wosw3
przegldarki internetowej3
si28
danych26
w25
na23
cookies22
serwisu21
uytkownika20
aflofarm18
do17
z16
climea15
dane15
s14
jest14
forte14
menopauzy13
mog13
osobowych13
lub13
od12
oraz11
okres11
ktre11
uytkownik11
plikw10
moe10
nie9
po9
zmiany9
prawo9
przetwarzania8
rwnie8
jak8
ich8
pliki8
za8
czy7
trwa7
skry7
informacje7
osobowe7
plus7
menopauza7
internetowej7
roku7
prywatnoci7
o7
07
climeapl6
prawa6
dotyczce6
r6
prawidowe6
tarczycy6
funkcjonowanie6
przed6
lat6
pomaga6
rozpoczyna6
zachowa6
kocowym6
wnbspserwisie6
ukadu5
dziki5
co5
dla5
d5
wszelkie5
jeli5
bd5
podstawie5
przeznbspuytkownika5
ok5
test5
przegldarki5
ktry5
kobiety5
czasie5
informacji5
gorca5
ten5
wikszo5
rodo5
e5
interes4
art4
ust4
14
m4
lit4
dotyczcych4
uzasadniony4
przepisw4
farmacja4
polska4
sp4
jeeli4
polityka4
strony4
przetwarzane4
stron4
wnbspkadym4
dziaania4
zgod4
serwis4
przy4
sposb4
dalej4
prawnie4
l4
produktw4
wspiera4
24
uderzenia4
ycia4
wnbsptym4
objaww4
tym4
te4
diety4
funkcjonowaniu4
objawy4
maj4
przez4
utrzymanie4
pomagaj4
times4
odpornociowego4
tego4
mu3
czas3
menopauzie3
nanbspurzdzeniu3
wanie3
su3
przeznbspaflofarm3
takich3
zbierane3
wnbspustawieniach3
ostatniej3
miesiczce3
ochrony3
anbsptake3
sesji3
rednio3
organy3
wygasanie3
usunicia3
przechowywane3
umowy3
bdzie3
f3
obsugi3
czynnoci3
podstaw3
jajnikw3
estrogenw3
fazie3
ostatni3
miesiczk3
stanowi3
nastpuje3
tej3
jedynie3
ostatecznie3
jod3
paznokci3
wpyw3
prawidowego3
95-2003
33
funkcjonowania3
zawiera3
g3
strona3
witamina3
produkcie3
wynika3
dziaanie3
osoba3
skr3
osb3
selen3
wosw3
pod3
przestaj3
praw3
funkcjonowa3
jajniki3
ona3
witaminy3
waciciela3
znbspdnia3
zmian3
wpywa3
sobie3
ale3
inne3
skadniki3
treci3
wspieraj3
rejestru3
wnbspokresie3
internetowego3
take3
ochronie3

Who hosts Climea.pl?

Climea.pl Hosting Provider Information

Hosted IP Address:212.160.230.212
Hosted Hostname:212.160.230.212
Service Provider:Orange Polska Spolka Akcyjna
Hosted Country:PolandPL
Location Latitude:53.3361
Location Longitude:23.1381
Webserver Software:Apache/2.4.41 (Fedora) OpenSSL/1.1.1g

Is "Orange Polska Spolka Akcyjna" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
19.8811%
GOOGLE
13.4918%
AS-26496-GO-DADDY-COM-LLC
3.5494%
NAMECHEAP-NET
3.0231%
AMAZON-AES
2.1497%
GoDaddy.com, LLC
2.0016%
UNIFIEDLAYER-AS-1
1.8740%
Fara Negar Pardaz Khuzestan
1.5314%
CONFLUENCE-NETWORK-INC
1.4027%
1&1 Internet AG
1.2887%
Orange Polska Spolka Akcyjna
0.0014%

HTTP Header Analysis for Climea.pl

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 07 Dec 2021 06:08:00 GMT
Server: Apache/2.4.41 (Fedora) OpenSSL/1.1.1g
Last-Modified: Mon, 25 Oct 2021 08:01:00 GMT
ETag: "a1aa-5cf28c2f48700"
Accept-Ranges: bytes
Content-Length: 41386
Content-Type: text/html; charset=UTF-8

Climea.pl Domain Nameserver Information

HostIP AddressCountry
dns.aflofarm.pl 212.160.230.222Poland Poland
ns.tpnet.pl 80.50.50.50Poland Poland


Need to find out who hosts Climea.pl?


Domain Registration (WhoIs) information for Climea.pl

 DOMAIN NAME: climea.pl
registrant type: organization
nameservers: dns.aflofarm.pl. [212.160.230.222]
ns.tpnet.pl. [80.50.50.50]
created: 2004.11.30 09:22:36
last modified: 2021.10.26 09:02:43
renewal date: 2022.11.30 09:22:36

no option

dnssec: Unsigned

REGISTRAR:
Agnat Sp. z o.o.
ul. Gdańska 119
85-022 Bydgoszcz
Polska/Poland
+48.52 3667777
+48.52 Login to show email
database responses: https://dns.pl/en/whois

WHOIS displays data with a delay not exceeding 15 minutes in relation to the .pl Registry system

Websites with Similar Names

Clime-net.com
403 - Forbidden
Clime.co
Clime.co World Weather Forecast, Weather in your location
Clime.com.au
Clime Investment Management
Clime.eco
Bhargav Groups – Bhargav Groups
Clime.eu
Home - Clime - Ihr Farbenspezialist
Clime.org
index.html
Clime.plus
Domain clime.plus registriert bei Domaintechnik®

Recently Updated Websites

Webk.net (9 seconds ago.)Bsbim.biz (10 seconds ago.)Ehirdavat.net (10 seconds ago.)Fttransportcorp.com (17 seconds ago.)Usgbccolorado.org (20 seconds ago.)68668.app (21 seconds ago.)Macquil.com (21 seconds ago.)Guardthehustle.com (25 seconds ago.)Sauria.com (26 seconds ago.)Pcjauditores.com (27 seconds ago.)Chinastzs.com (29 seconds ago.)Yaga-game.com (30 seconds ago.)Bloggersdaily.com (31 seconds ago.)Schweizermedien.net (31 seconds ago.)Aperitivotwentytwenty.com (32 seconds ago.)Wcaf.jp (33 seconds ago.)Socialdistancingheadgears.com (34 seconds ago.)Westwindautomotive.com (35 seconds ago.)Eduenglishuk.com (35 seconds ago.)Fusionmember.com (36 seconds ago.)Cbcaknights.org (36 seconds ago.)Perrilawrence.info (37 seconds ago.)Groutsmithstuart.com (38 seconds ago.)Iepet.com.br (39 seconds ago.)Rev4kidz.com (40 seconds ago.)Miyazakishoten.com (40 seconds ago.)Ceresfrontierfoundation.org (41 seconds ago.)Boyuvip569.vip (41 seconds ago.)Propuls.fr (43 seconds ago.)Celebrator.xyz (43 seconds ago.)

Recently Searched Keywords

2020 microsoft office (3 seconds ago.)материальные условия (4 seconds ago.)2011 1 (4 seconds ago.)usage your own money to gamble anywhere you like (5 seconds ago.)webinterface (6 seconds ago.)home therapy (6 seconds ago.)prohibition signs (6 seconds ago.)教改立项 (6 seconds ago.)rapidlash reviews before and after (7 seconds ago.)ostukorv (7 seconds ago.)欧乐影院 (9 seconds ago.)datepublished 2020-05-24 datemodified (10 seconds ago.)wood beds (10 seconds ago.)ausgabe bestellen heft (11 seconds ago.)i go to a support group for my addiction to men (11 seconds ago.)central post office sharjah (12 seconds ago.)idimageidd9bcfce563e7c515f96b4426651ca821e08afbfb8ef55f299b3af439bfbe7da2c-image-container--align-center hp-image (13 seconds ago.)infinix note 8 (14 seconds ago.)adult parties (14 seconds ago.)cavab hrmtli (17 seconds ago.)fabrizio (19 seconds ago.)pope messages (23 seconds ago.)wp-includesmediaphp (24 seconds ago.)hochschule darmstadt (25 seconds ago.)defineddefaultimagefalse defaultimage appid3 (25 seconds ago.)livethe senate will vote to advance another scaled-down relief package, but it is unlikely to pass. here’s the latest. (26 seconds ago.)campus life students are encouraged to indulge in various activities through our clubs & houses showcasing their skills, thereby celebrating every moment of their life. apply now (26 seconds ago.)1373 ne village squire ct gresham or (29 seconds ago.)excepteur est (30 seconds ago.)amd ryzen 9 3900x cpu 4 cores 12 gb ram 160gb nvme ssd 12tb transfer @1gbps port $289 (30 seconds ago.)