Cmtcovm-no.org Favicon Cmtcovm-no.org

Cmtcovm-no.org Website Thumbnail
Checking...
Home - CMTC-OVM
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
cmtcovm-no
Domain extension
org
Domain registered:
2016-07-03
Domain updated:
2020-09-15
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is cmtcovm-no.org ranked relative to other sites:

Percentage of visits to cmtcovm-no.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Cmtcovm-no.org registered?
A: Cmtcovm-no.org was registered 4 years, 2 months, 4 weeks, 1 day, 13 hours, 36 minutes, 56 seconds ago on Sunday, July 3, 2016.
Q: When was the WHOIS for Cmtcovm-no.org last updated?
A: The WHOIS entry was last updated 2 weeks, 2 days, 13 hours, 36 minutes, 56 seconds ago on Tuesday, September 15, 2020.
Q: What are Cmtcovm-no.org's nameservers?
A: DNS for Cmtcovm-no.org is provided by the following nameservers:
  • sandra.neostrada.nl
  • lisa.neostrada.nl
  • christina.neostrada.nl
Q: Who is the registrar for the Cmtcovm-no.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Cmtcovm-no.org?
A: Cmtcovm-no.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Cmtcovm-no.org each day?
A: Cmtcovm-no.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Cmtcovm-no.org resolve to?
A: Cmtcovm-no.org resolves to the IPv4 address 31.186.169.41.
Q: In what country are Cmtcovm-no.org servers located in?
A: Cmtcovm-no.org has servers located in the Netherlands.
Q: What webserver software does Cmtcovm-no.org use?
A: Cmtcovm-no.org is powered by Apache webserver.
Q: Who hosts Cmtcovm-no.org?
A: Cmtcovm-no.org is hosted by LeaseWeb Netherlands B.V. in Netherlands.
Q: How much is Cmtcovm-no.org worth?
A: Cmtcovm-no.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Cmtcovm-no.org?

Cmtcovm-no.org Hosting Provider Information

Hosted IP Address:31.186.169.41
Hosted Hostname:redirect.totaalholding.nl
Service Provider:LeaseWeb Netherlands B.V.
Hosted Country:NetherlandsNL
Location Latitude:52.3824
Location Longitude:4.8995
Webserver Software:Apache

Is "LeaseWeb Netherlands B.V." in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Cmtcovm-no.org

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Tue, 15 Sep 2020 04:49:37 GMT
Server: Apache
Location: https://cmtc.nl/
Content-Length: 224
Content-Type: text/html; charset=iso-8859-1

Cmtcovm-no.org Domain Nameserver Information

HostIP AddressCountry
sandra.neostrada.nl 85.17.199.26
lisa.neostrada.nl 66.228.38.167
christina.neostrada.nl 172.104.143.74


Need to find out who hosts Cmtcovm-no.org?


WhoIs information for Cmtcovm-no.org

 Domain Name: CMTCOVM-NO.ORG
Registry Domain ID: D186988101-LROR
Registrar WHOIS Server: whois.rrpproxy.net
Registrar URL: http://www.key-systems.net
Updated Date: 2020-05-18T14:15:38Z
Creation Date: 2016-03-07T18:18:37Z
Registry Expiry Date: 2022-03-07T18:18:37Z
Registrar Registration Expiration Date:
Registrar: Key-Systems GmbH
Registrar IANA ID: 269
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +49.68949396850
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registrant Organization:
Registrant State/Province:
Registrant Country: NL
Name Server: SANDRA.NEOSTRADA.NL
Name Server: LISA.NEOSTRADA.NL
Name Server: CHRISTINA.NEOSTRADA.NL
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-08-09T20:31:44Z

Cmtcovm-no.org Free SEO Report

Website Inpage Analysis for Cmtcovm-no.org

H1 Headings

1 :
  1. Voor patiënten en families met CMTC en Overige Vasculaire (bloedvat) Malformaties

H2 Headings

3 :
  1. Laatste nieuws en activiteiten
  2. 12 jaar geleden (2006) werd onze zoon geboren. Heel snel.
  3. Uw steun doet er toe

H3 Headings

10 :
  1. Zeldzame ziekten Australië & CMTC-OVM
  2. Zeldzame ziekten Oostenrijk & CMTC-OVM
  3. Zeldzame ziekten China & CMTC-OVM
  4. Andersom denken in patiëntenorganisaties
  5. Wereldwijde Leden Conferentie 2020: online
  6. Zeldzame ziekten Kenia & CMTC-OVM
  7. Werkt Sirolimus bij vasculaire malformaties?
  8. Veilige online community enquête (één vraag)
  9. Aankomende evenementen
  10. Twitter

H4 Headings

19 :
  1. Daily each 3 days
  2. Daily each 3 days
  3. Weekly on Mondays
  4. Daily each 3 days
  5. Daily each 3 days
  6. Monthly on 27th
  7. Daily each 3 days
  8. Weekly on Mondays
  9. Daily each 3 days
  10. Daily each 3 days
  11. Weekly on Mondays
  12. Daily each 3 days
  13. 12 JAAR GELEDEN WERD ONZE ZOON GEBOREN
  14. REGISTEER ALS LID
  15. DRAAG BIJ & DONEER
  16. SPONSOR ONZE ACTIVITEITEN
  17. WORD VRIJWILLIGER
  18. Volg ons op
  19. Nieuwsbrief

H5 Headings

1 :
  1. CMTC-OVM is een wereldwijde non-profit patiënten organisatie en heeft als doel de kwaliteit van het leven te verbeteren van mensen die lijden aan vasculaire malformaties (bloedvat afwijkingen), zoals CMTC (‘Van Lohuizen syndroom’), en het stimuleren van wetenschappelijk onderzoek naar deze malformaties.

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

129 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

270:
  1. No text
    https://www.cmtc.nl
  2. No text
    https://www.cmtc.nl/en/
  3. Home
    https://www.cmtc.nl/
  4. Pedia
    https://www.cmtc.nl/pedia/
  5. CMTC
    https://www.cmtc.nl/pedia/cmtc/
  6. Beschrijving
    https://www.cmtc.nl/pedia/cmtc/beschrijving-uitgebreid/
  7. Fotogalerij
    https://www.cmtc.nl/pedia/cmtc/fotogalerij/
  8. Mogelijke complicaties
    https://www.cmtc.nl/pedia/cmtc/mogelijke-complicaties/
  9. Mogelijke complicaties per locatie
    https://www.cmtc.nl/pedia/cmtc/mogelijke-complicaties-per-locatie/
  10. Informatiefolder CMTC
    https://www.cmtc.nl/pedia/cmtc/informatiefolder-cmtc/
  11. Laserbehandeling
    https://www.cmtc.nl/pedia/cmtc/laserbehandeling/
  12. Afkortingen en begrippen
    https://www.cmtc.nl/pedia/cmtc/afkortingen-en-begrippen/
  13. Dr. van Lohuizen
    https://www.cmtc.nl/pedia/cmtc/dr-van-lohuizen/
  14. CMTC artikelen
    https://www.cmtc.nl/pedia/cmtc/cmtc-artikelen/
  15. OVM
    https://www.cmtc.nl/pedia/ovm/
  16. AV malformatie
    https://www.cmtc.nl/pedia/ovm/av-malformatie/
  17. Capillaire malformatie
    https://www.cmtc.nl/pedia/ovm/capillaire-malformatie/
  18. CMTC (OVM)
    https://www.cmtc.nl/pedia/ovm/cmtc-ovm/
  19. Complex gemengde malformatie
    https://www.cmtc.nl/pedia/ovm/complex-gemengde-malformatie/
  20. Congenitaal hemangioom (NICH/RICH)
    https://www.cmtc.nl/pedia/ovm/congenitaal-hemangioom-nich-rich/
  21. Diffuse Capillaire Malformatie met Overgroei (DCMO)
    https://www.cmtc.nl/pedia/ovm/diffuse-capillaire-malformatie-met-overgroei-dcmo/
  22. Granuloma telangiectaticum
    https://www.cmtc.nl/pedia/ovm/granuloma-telangiectaticum/
  23. Hemangio-endothelioom
    https://www.cmtc.nl/pedia/ovm/hemangio-endothelioom/
  24. Infantiel hemangioom
    https://www.cmtc.nl/pedia/ovm/infantiel-hemangioom/
  25. Klippel-Trenaunay
    https://www.cmtc.nl/pedia/ovm/klippel-trenaunay/
  26. Lymfatische malformatie
    https://www.cmtc.nl/pedia/ovm/lymfatische-malformatie/
  27. Ooievaarsbeet
    https://www.cmtc.nl/pedia/ovm/ooievaarsbeet/
  28. Sturge-Weber
    https://www.cmtc.nl/pedia/ovm/sturge-weber/
  29. Teleangiëctasieën
    https://www.cmtc.nl/pedia/ovm/teleangiectasieen/
  30. Tufted angioma
    https://www.cmtc.nl/pedia/ovm/tufted-angioma/
  31. Veneuze malformatie
    https://www.cmtc.nl/pedia/ovm/veneuze-malformatie/
  32. Wijnvlek
    https://www.cmtc.nl/pedia/ovm/wijnvlek/
  33. Multidisciplinair spreekuur
    https://www.cmtc.nl/pedia/ovm/multidisciplinair-spreekuur/
  34. Behandeling vasculaire malformaties met interventieradiologie
    https://www.cmtc.nl/pedia/ovm/behandeling-vasculaire-malformaties-met-interventieradiologie/
  35. Behandeling 10%
    https://www.cmtc.nl/pedia/ovm/behandeling-10/
  36. Laser behandeling OVM
    https://www.cmtc.nl/pedia/ovm/laser-behandeling-ovm/
  37. Huid
    https://www.cmtc.nl/pedia/huid/
  38. Huidveroudering
    https://www.cmtc.nl/pedia/huid/huidveroudering/
  39. Melanomen en moedervlekken
    https://www.cmtc.nl/pedia/huid/melanomen-en-moedervlekken/
  40. Huidtherapie
    https://www.cmtc.nl/pedia/huid/huidtherapie/
  41. UV straling
    https://www.cmtc.nl/pedia/huid/uv-straling/
  42. Psychologie
    https://www.cmtc.nl/pedia/psychologie/
  43. Huidaandoeningen en psychologische aspecten
    https://www.cmtc.nl/pedia/psychologie/huidaandoeningen-en-psychologische-aspecten/
  44. Na de geboorte
    https://www.cmtc.nl/pedia/psychologie/na-de-geboorte/
  45. Reacties omgeving
    https://www.cmtc.nl/pedia/psychologie/reacties-omgeving/
  46. Toestand kind
    https://www.cmtc.nl/pedia/psychologie/toestand-kind/
  47. School en vrienden
    https://www.cmtc.nl/pedia/psychologie/school-en-vrienden/
  48. Na de diagnose
    https://www.cmtc.nl/pedia/psychologie/na-de-diagnose/
  49. Medische begeleiding
    https://www.cmtc.nl/pedia/psychologie/medische-begeleiding/
  50. Pesten
    https://www.cmtc.nl/pedia/psychologie/pesten/
  51. Mogelijke gevolgen
    https://www.cmtc.nl/pedia/psychologie/mogelijke-gevolgen/
  52. Acceptatie
    https://www.cmtc.nl/pedia/psychologie/acceptatie/
  53. Ontmoet Chloe
    https://www.cmtc.nl/pedia/psychologie/ontmoet-chloe/
  54. Broer of zus ziek
    https://www.cmtc.nl/pedia/psychologie/broer-of-zus-ziek/
  55. Leef als een beest
    https://www.cmtc.nl/pedia/psychologie/leef-als-een-beest/
  56. Ziektelast
    https://www.cmtc.nl/pedia/psychologie/ziektelast/
  57. Op de bres voor een kindgerichte aanpak
    https://www.cmtc.nl/pedia/psychologie/op-de-bres-voor-een-kindgerichte-aanpak/
  58. eHealth
    https://www.cmtc.nl/pedia/ehealth/
  59. Telehealth en medische diagnoses
    https://www.cmtc.nl/pedia/ehealth/telehealth-en-medische-diagnoses/
  60. Digitale gezondheid
    https://www.cmtc.nl/pedia/ehealth/digitale-gezondheid/
  61. Virtuele verpleegkundige
    https://www.cmtc.nl/pedia/ehealth/virtuele-verpleegkundige/
  62. Genetica
    https://www.cmtc.nl/pedia/genetica/
  63. Reverse-phenotyping in patiënten met capillaire bloedvatafwijkingen in de huid
    https://www.cmtc.nl/pedia/genetica/reverse-phenotyping-in-patienten-met-capillaire-bloedvatafwijkingen-in-de-huid/
  64. Genetica woordenlijst
    https://www.cmtc.nl/pedia/genetica/genetica-woordenlijst/
  65. Pedia overig
    https://www.cmtc.nl/pedia/pedia-overig/
  66. European Patient Advocay Groups (ePAG’s)
    https://www.cmtc.nl/pedia/pedia-overig/european-patient-advocay-groups-epags/
  67. European Reference Networks (ERN’s)
    https://www.cmtc.nl/pedia/pedia-overig/european-reference-networks-erns/
  68. ISSVA klassificatie
    https://www.cmtc.nl/pedia/pedia-overig/issva-klassificatie/
  69. Samen beslissen
    https://www.cmtc.nl/pedia/pedia-overig/samen-beslissen/
  70. Stem patiënt
    https://www.cmtc.nl/pedia/pedia-overig/stem-patient/
  71. Zeldzame ziekten barometer
    https://www.cmtc.nl/pedia/pedia-overig/zeldzame-ziekten-barometer/
  72. Nieuwe ontwikkeling laser
    https://www.cmtc.nl/pedia/pedia-overig/nieuwe-ontwikkeling-laser/
  73. Rechten patiënt
    https://www.cmtc.nl/pedia/pedia-overig/rechten-patient/
  74. Waardering zorgaanbieders NL
    https://www.cmtc.nl/pedia/pedia-overig/waardering-zorgaanbieders-nl/
  75. Holistische persoons gecentreerde zorg
    https://www.cmtc.nl/pedia/pedia-overig/holistische-persoons-gecentreerde-zorg/
  76. ‘State of the art’ activiteiten zeldzame ziekten Europa
    https://www.cmtc.nl/pedia/pedia-overig/state-of-the-art-activiteiten-zeldzame-ziekten-europa/
  77. Sirolimus
    https://www.cmtc.nl/pedia/pedia-overig/sirolimus/
  78. Kennisbank
    https://www.cmtc.nl/kennisbank/
  79. Links websites
    https://www.cmtc.nl/kennisbank/links-websites/
  80. Huidziekten organisaties
    https://www.cmtc.nl/kennisbank/links-websites/huidziekten-organisaties/
  81. Overige organisaties
    https://www.cmtc.nl/kennisbank/links-websites/overige-organisaties/
  82. Patiënten websites
    https://www.cmtc.nl/kennisbank/links-websites/patienten-websites/
  83. Samenwerking
    https://www.cmtc.nl/kennisbank/links-websites/samenwerking/
  84. Vasculaire ziekten organisaties
    https://www.cmtc.nl/kennisbank/links-websites/vasculaire-ziekten-organisaties/
  85. Zeldzame ziekten organisaties
    https://www.cmtc.nl/kennisbank/links-websites/zeldzame-ziekten-organisaties/
  86. Ziekenhuizen
    https://www.cmtc.nl/kennisbank/links-websites/ziekenhuizen/
  87. FAQ’s
    https://www.cmtc.nl/kennisbank/faqs/
  88. FAQ CMTC
    https://www.cmtc.nl/kennisbank/faqs/faq-cmtc/
  89. FAQ OVM
    https://www.cmtc.nl/kennisbank/faqs/faq-ovm/
  90. FAQ Psychologie
    https://www.cmtc.nl/kennisbank/faqs/faq-psychologie/
  91. Video’s
    https://www.cmtc.nl/kennisbank/videos/
  92. Informatie
    https://www.cmtc.nl/kennisbank/videos/informatie/
  93. Promotie
    https://www.cmtc.nl/kennisbank/videos/promotie/
  94. Overige
    https://www.cmtc.nl/kennisbank/videos/overige/
  95. Documenten
    https://www.cmtc.nl/kennisbank/documenten/
  96. Presentaties
    https://www.cmtc.nl/kennisbank/presentaties/
  97. Presentaties CORD 2019
    https://www.cmtc.nl/kennisbank/presentaties/presentaties-cord-2019/
  98. Presentaties Eurordis 2019
    https://www.cmtc.nl/kennisbank/presentaties/presentaties-eurordis-2019/
  99. Presentaties Eurordis 2018
    https://www.cmtc.nl/kennisbank/presentaties/presentaties-eurordis-2018/
  100. Presentaties Eurordis 2017
    https://www.cmtc.nl/kennisbank/presentaties/presentaties-eurordis-2017/
  101. Nieuws
    https://www.cmtc.nl/kennisbank/nieuws/
  102. Laatste nieuws
    https://www.cmtc.nl/kennisbank/nieuws/laatste-nieuws/
  103. Evenementen
    https://www.cmtc.nl/kennisbank/nieuws/evenementen/
  104. Externe conferenties intro
    https://www.cmtc.nl/kennisbank/nieuws/externe-conferenties-intro/
  105. Nieuwsbrieven
    https://www.cmtc.nl/kennisbank/nieuws/nieuwsbrieven/
  106. Leden
    https://www.cmtc.nl/leden/
  107. Registratie
    https://www.cmtc.nl/leden/registratie/
  108. Lid registratie
    https://www.cmtc.nl/leden/registratie/lid-registratie/
  109. Donateur registratie
    https://www.cmtc.nl/leden/registratie/donateur-registratie/
  110. Medisch advies
    https://www.cmtc.nl/leden/medisch-advies/
  111. Persoonlijk medisch advies
    https://www.cmtc.nl/leden/medisch-advies/persoonlijk-medisch-advies/
  112. Medische diagnose feiten
    https://www.cmtc.nl/leden/medisch-advies/medische-diagnose-feiten/
  113. Persoonlijke begeleiding
    https://www.cmtc.nl/leden/medisch-advies/persoonlijke-begeleiding/
  114. Leden conferenties
    https://www.cmtc.nl/leden/leden-conferenties/
  115. Nederland
    https://www.cmtc.nl/leden/leden-conferenties/nederland/
  116. Canada
    https://www.cmtc.nl/leden/leden-conferenties/canada/
  117. USA
    https://www.cmtc.nl/leden/leden-conferenties/usa/
  118. Familiedagen
    https://www.cmtc.nl/leden/familiedagen/
  119. Persoonlijke verhalen
    https://www.cmtc.nl/leden/persoonlijke-verhalen/
  120. Word geïnformeerd
    https://www.cmtc.nl/leden/word-geinformeerd/
  121. Social media
    https://www.cmtc.nl/leden/word-geinformeerd/social-media/
  122. Social media kanalen
    https://www.cmtc.nl/leden/word-geinformeerd/social-media-kanalen/
  123. Social media gratis?
    https://www.cmtc.nl/leden/word-geinformeerd/social-media-gratis/
  124. Nieuwsbrief
    https://www.cmtc.nl/leden/word-geinformeerd/nieuwsbrief/
  125. Medisch alarm
    https://www.cmtc.nl/leden/word-geinformeerd/medisch-alarm/
  126. Bezoek Nederland
    https://www.cmtc.nl/leden/word-geinformeerd/bezoek-nederland/
  127. Familieberichten
    https://www.cmtc.nl/leden/familieberichten/
  128. Activiteiten
    https://www.cmtc.nl/activiteiten/
  129. Genetisch onderzoek
    https://www.cmtc.nl/activiteiten/genetisch-onderzoek/
  130. Deelname
    https://www.cmtc.nl/activiteiten/genetisch-onderzoek/deelname/
  131. Status
    https://www.cmtc.nl/activiteiten/genetisch-onderzoek/status/
  132. Informatie folders
    https://www.cmtc.nl/activiteiten/informatie-folders/
  133. CMTC folder
    https://www.cmtc.nl/activiteiten/informatie-folders/cmtc-folder/
  134. Brussen folder
    https://www.cmtc.nl/activiteiten/informatie-folders/brussen-folder/
  135. Psychologie folder
    https://www.cmtc.nl/activiteiten/informatie-folders/psychologie-folder/
  136. Zorgverlener folder
    https://www.cmtc.nl/activiteiten/informatie-folders/zorgverlener-folder/
  137. Huisartsenbrochure
    https://www.cmtc.nl/activiteiten/informatie-folders/huisartsenbrochure/
  138. Patiënt reis
    https://www.cmtc.nl/activiteiten/informatie-folders/patient-reis/
  139. Patiënt inbegrepen
    https://www.cmtc.nl/activiteiten/informatie-folders/patient-inbegrepen/
  140. Patiënt belangenbehartiging
    https://www.cmtc.nl/activiteiten/patient-belangenbehartiging/
  141. Overzicht per land
    https://www.cmtc.nl/activiteiten/patient-belangenbehartiging/overzicht-per-land/
  142. Aanmoedigingsprogramma
    https://www.cmtc.nl/activiteiten/patient-belangenbehartiging/aanmoedigingsprogramma/
  143. Externe conferenties
    https://www.cmtc.nl/activiteiten/externe-conferenties/
  144. Conferentie deelname
    https://www.cmtc.nl/activiteiten/externe-conferenties/conferentie-deelname/
  145. CORD
    https://www.cmtc.nl/activiteiten/externe-conferenties/cord/
  146. EADV
    https://www.cmtc.nl/activiteiten/externe-conferenties/eadv/
  147. Eurordis
    https://www.cmtc.nl/activiteiten/externe-conferenties/eurordis/
  148. Genetic Alliance
    https://www.cmtc.nl/activiteiten/externe-conferenties/genetic-alliance/
  149. Global Skin Foundation
    https://www.cmtc.nl/activiteiten/externe-conferenties/global-skin-foundation/
  150. ICORD
    https://www.cmtc.nl/activiteiten/externe-conferenties/icord/
  151. NORD
    https://www.cmtc.nl/activiteiten/externe-conferenties/nord/
  152. VBF
    https://www.cmtc.nl/activiteiten/externe-conferenties/vbf/
  153. Zeldzame ziekten dag
    https://www.cmtc.nl/activiteiten/externe-conferenties/zeldzame-ziekten-dag/
  154. Overige conferenties
    https://www.cmtc.nl/activiteiten/externe-conferenties/overige-conferenties/
  155. Community stem
    https://www.cmtc.nl/activiteiten/community-stem/
  156. Online community
    https://www.cmtc.nl/activiteiten/online-community/
  157. Projecten
    https://www.cmtc.nl/activiteiten/projecten/
  158. Organisatie
    https://www.cmtc.nl/organisatie/
  159. Over onze organisatie
    https://www.cmtc.nl/organisatie/over-onze-organisatie/
  160. Bestuur
    https://www.cmtc.nl/organisatie/over-onze-organisatie/bestuur/
  161. Contact
    https://www.cmtc.nl/organisatie/over-onze-organisatie/contact/
  162. Adviesraad
    https://www.cmtc.nl/organisatie/over-onze-organisatie/adviesraad/
  163. Jaarverslagen
    https://www.cmtc.nl/organisatie/over-onze-organisatie/jaarverslagen/
  164. Kascommissie
    https://www.cmtc.nl/organisatie/over-onze-organisatie/kascommissie/
  165. Beleidsplan
    https://www.cmtc.nl/organisatie/over-onze-organisatie/beleidsplan/
  166. Begrotingen
    https://www.cmtc.nl/organisatie/over-onze-organisatie/begrotingen/
  167. Begroting 2020
    https://www.cmtc.nl/organisatie/over-onze-organisatie/begrotingen/begroting-2020/
  168. Begroting 2019
    https://www.cmtc.nl/organisatie/over-onze-organisatie/begrotingen/begroting-2019/
  169. Keurmerken
    https://www.cmtc.nl/organisatie/over-onze-organisatie/keurmerken/
  170. Gedragscode
    https://www.cmtc.nl/organisatie/over-onze-organisatie/gedragscode/
  171. Invloed en medezeggenschap
    https://www.cmtc.nl/organisatie/over-onze-organisatie/invloed-en-medezeggenschap/
  172. Impact en bereik
    https://www.cmtc.nl/organisatie/over-onze-organisatie/impact-en-bereik/
  173. Klachten
    https://www.cmtc.nl/organisatie/over-onze-organisatie/klachten/
  174. Statuten
    https://www.cmtc.nl/organisatie/over-onze-organisatie/statuten/
  175. Huishoudelijk reglement
    https://www.cmtc.nl/organisatie/over-onze-organisatie/huishoudelijk-reglement/
  176. Belangenverstrengeling
    https://www.cmtc.nl/organisatie/over-onze-organisatie/belangenverstrengeling/
  177. Proclaimer
    https://www.cmtc.nl/organisatie/over-onze-organisatie/proclaimer/
  178. Adviseurs
    https://www.cmtc.nl/organisatie/adviseurs/
  179. Ambassadeurs
    https://www.cmtc.nl/organisatie/ambassadeurs/
  180. Samenwerking
    https://www.cmtc.nl/organisatie/samenwerking/
  181. Privacy
    https://www.cmtc.nl/organisatie/privacy/
  182. Jouw rechten
    https://www.cmtc.nl/organisatie/privacy/jouw-rechten/
  183. Verklaring
    https://www.cmtc.nl/organisatie/privacy/verklaring/
  184. Inzage regeling
    https://www.cmtc.nl/organisatie/privacy/inzage-regeling/
  185. Registratie gegevens
    https://www.cmtc.nl/organisatie/privacy/registratie-gegevens/
  186. Jouw privacy, onze zorg
    https://www.cmtc.nl/organisatie/privacy/jouw-privacy-onze-zorg/
  187. Veilige e-mail
    https://www.cmtc.nl/organisatie/privacy/veilige-e-mail/
  188. Privacy & beveiling tips
    https://www.cmtc.nl/organisatie/privacy/privacy-beveiling-tips/
  189. Onze infrastructuur
    https://www.cmtc.nl/organisatie/privacy/onze-infrastructuur/
  190. Donateur
    https://www.cmtc.nl/organisatie/donateur/
  191. Sponsor
    https://www.cmtc.nl/organisatie/sponsor/
  192. Onze sponsors
    https://www.cmtc.nl/organisatie/sponsor/onze-sponsors/
  193. Vrijwilliger
    https://www.cmtc.nl/organisatie/vrijwilliger/
  194. Onze vrijwilligers
    https://www.cmtc.nl/organisatie/vrijwilliger/onze-vrijwilligers/
  195. Profielen
    https://www.cmtc.nl/organisatie/vrijwilliger/profielen/
  196. No text
    https://www.cmtc.nl/
  197. LEES MEER OVER ONZE ORGANISATIE
    https://www.cmtc.nl/organisatie/over-onze-organisatie/
  198.  
    https://www.cmtc.nl/zeldzame-ziekten-australie-cmtc-ovm/
  199. Zeldzame ziekten Australië & CMTC-OVM
    https://www.cmtc.nl/zeldzame-ziekten-australie-cmtc-ovm/
  200. 31-08-2020
    https://www.cmtc.nl/2020/08/
  201. Lees meer
    https://www.cmtc.nl/zeldzame-ziekten-australie-cmtc-ovm/
  202.  
    https://www.cmtc.nl/zeldzame-ziekten-oostenrijk-cmtc-ovm/
  203. Zeldzame ziekten Oostenrijk & CMTC-OVM
    https://www.cmtc.nl/zeldzame-ziekten-oostenrijk-cmtc-ovm/
  204. 29-08-2020
    https://www.cmtc.nl/2020/08/
  205. Lees meer
    https://www.cmtc.nl/zeldzame-ziekten-oostenrijk-cmtc-ovm/
  206.  
    https://www.cmtc.nl/zeldzame-ziekten-china-cmtc-ovm/
  207. Zeldzame ziekten China & CMTC-OVM
    https://www.cmtc.nl/zeldzame-ziekten-china-cmtc-ovm/
  208. 26-08-2020
    https://www.cmtc.nl/2020/08/
  209. Lees meer
    https://www.cmtc.nl/zeldzame-ziekten-china-cmtc-ovm/
  210.  
    https://www.cmtc.nl/andersom-denken-in-patientenorganisaties/
  211. Andersom denken in patiëntenorganisaties
    https://www.cmtc.nl/andersom-denken-in-patientenorganisaties/
  212. Lees meer
    https://www.cmtc.nl/andersom-denken-in-patientenorganisaties/
  213.  
    https://www.cmtc.nl/wereldwijde-leden-conferentie-2020-online/
  214. Wereldwijde Leden Conferentie 2020: online
    https://www.cmtc.nl/wereldwijde-leden-conferentie-2020-online/
  215. 20-08-2020
    https://www.cmtc.nl/2020/08/
  216. Lees meer
    https://www.cmtc.nl/wereldwijde-leden-conferentie-2020-online/
  217.  
    https://www.cmtc.nl/zeldzame-ziekten-kenia-cmtc-ovm/
  218. Zeldzame ziekten Kenia & CMTC-OVM
    https://www.cmtc.nl/zeldzame-ziekten-kenia-cmtc-ovm/
  219. Lees meer
    https://www.cmtc.nl/zeldzame-ziekten-kenia-cmtc-ovm/
  220.  
    https://www.cmtc.nl/werkt-sirolimus-bij-vasculaire-malformaties/
  221. Werkt Sirolimus bij vasculaire malformaties?
    https://www.cmtc.nl/werkt-sirolimus-bij-vasculaire-malformaties/
  222. 11-08-2020
    https://www.cmtc.nl/2020/08/
  223. Lees meer
    https://www.cmtc.nl/werkt-sirolimus-bij-vasculaire-malformaties/
  224.  
    https://www.cmtc.nl/veilige-online-community-enquete-een-vraag/
  225. Veilige online community enquête (één vraag)
    https://www.cmtc.nl/veilige-online-community-enquete-een-vraag/
  226. 06-08-2020
    https://www.cmtc.nl/2020/08/
  227. Lees meer
    https://www.cmtc.nl/veilige-online-community-enquete-een-vraag/
  228. Daily each 3 days
    https://www.cmtc.nl/events/daily-each-3-days/
  229. Bekijk detail
    https://www.cmtc.nl/events/daily-each-3-days/
  230. Weekly on Mondays
    https://www.cmtc.nl/events/weekly-on-mondays/
  231. Bekijk detail
    https://www.cmtc.nl/events/weekly-on-mondays/
  232. Monthly on 27th
    https://www.cmtc.nl/events/monthly-on-27th/
  233. Bekijk detail
    https://www.cmtc.nl/events/monthly-on-27th/
  234. Lees meer persoonlijke verhalen
    https://www.cmtc.nl/leden/persoonlijke-verhalen/
  235. REGISTEER ALS LID
    https://www.cmtc.nl/leden/registratie/lid-registratie/
  236. DONEER
    https://www.cmtc.nl/leden/registratie/donateur-registratie/
  237. SPONSOR
    https://www.cmtc.nl/organisatie/sponsor/
  238. WORDT VRIJWILLIGER
    https://www.cmtc.nl/organisatie/vrijwilliger/
  239. Retweet on Twitter
    https://twitter.com/intent/user?screen_name=CMTCOVM
  240. CMTC-OVM Retweeted
    https://twitter.com/CMTCOVM
  241. No text
    https://twitter.com/MiikkaVikkula
  242. Miikka. Vikkula
    https://twitter.com/MiikkaVikkula
  243. @MiikkaVikkula
    https://twitter.com/MiikkaVikkula
  244. 13 sep
    https://twitter.com/MiikkaVikkula/status/1305040080168456192
  245. Reply on Twitter 1305040080168456192
    https://twitter.com/intent/tweet?in_reply_to=1305040080168456192&related=MiikkaVikkula
  246. Retweet on Twitter 13050400801684561926
    https://twitter.com/intent/retweet?tweet_id=1305040080168456192&related=MiikkaVikkula
  247. Like on Twitter 130504008016845619229
    https://twitter.com/intent/like?tweet_id=1305040080168456192&related=MiikkaVikkula
  248. Twitter 1305040080168456192
    https://twitter.com/MiikkaVikkula/status/1305040080168456192
  249. 11 sep
    https://twitter.com/MiikkaVikkula/status/1304382214654885888
  250. [email protected] Miikka Vikkula @MiikkaVikkula and his team at @deDuveInstitute Human Molecular #Genetics Laboratory, have identified a new gene responsible for #primarylymphoedema: #ANGPT2! 👏 Read all about it here: https://uclouvain.be/en/sciencetoday/news/piecing-together-the-primary-lymphoedema-puzzle.html #ERNeu #research #PPL #lymphedema #RareDisease
    https://twitter.com/vascern/status/1304321872146968576
  251. Reply on Twitter 1304382214654885888
    https://twitter.com/intent/tweet?in_reply_to=1304382214654885888&related=MiikkaVikkula
  252. Retweet on Twitter 13043822146548858883
    https://twitter.com/intent/retweet?tweet_id=1304382214654885888&related=MiikkaVikkula
  253. Like on Twitter 130438221465488588811
    https://twitter.com/intent/like?tweet_id=1304382214654885888&related=MiikkaVikkula
  254. Twitter 1304382214654885888
    https://twitter.com/MiikkaVikkula/status/1304382214654885888
  255. No text
    https://twitter.com/CMTCOVM
  256. CMTC-OVM
    https://twitter.com/CMTCOVM
  257. @CMTCOVM
    https://twitter.com/CMTCOVM
  258. 10 sep
    https://twitter.com/CMTCOVM/status/1303969827590111232
  259. No text
    https://twitter.com/CMTCOVM/status/1303969827590111232
  260. Reply on Twitter 1303969827590111232
    https://twitter.com/intent/tweet?in_reply_to=1303969827590111232&related=CMTCOVM
  261. Retweet on Twitter 1303969827590111232
    https://twitter.com/intent/retweet?tweet_id=1303969827590111232&related=CMTCOVM
  262. Like on Twitter 13039698275901112321
    https://twitter.com/intent/like?tweet_id=1303969827590111232&related=CMTCOVM
  263. Twitter 1303969827590111232
    https://twitter.com/CMTCOVM/status/1303969827590111232
  264. No text
    https://www.cmtc.nl/leden/word-geinformeerd/social-media-kanalen/
  265. No text
    https://twitter.com/#!/cmtcovm
  266. No text
    https://www.linkedin.com/company/5024915?trk=tyah&trkInfo=tas%3Acmtc%2Cidx%3A1-3-3
  267. No text
    https://www.youtube.com/channel/UCh6lHgOkcmkY9o6xJXs6lDQ/
  268. No text
    https://www.instagram.com/cmtcovm/
  269. Ik ga akkoord met de verwerking van mijn persoonlijke gegevens
    https://www.cmtc.nl/organisatie/privacy/verklaring/
  270. Sitemap
    https://www.cmtc.nl/sitemap_index.xml

Links - Outbound (nofollow)

2:
  1. No text
    https://www.youtube.com/channel/UCh6lHgOkcmkY9o6xJXs6lDQ/
  2. No text
    https://www.instagram.com/cmtcovm/

Keyword Cloud for Cmtcovm-no.org

pricemaandagmkbutton43detail context httpschemaorgeuropeanleft0hebbenurl httpswwwcmtcnleventsdailyeach3daysmksvgiconhttpschemaorg typeavailability httpsschemaorginstockdeelnameeach 3imageeurordisdetail contextpagesectioncontent20200928038days url httpswwwcmtcnleventsdailyeach3daysperson name url4colorffffff importantheight100maandag bekijk detaildetailhave3 days urlmksvgicon colorffffffdescription image namehttpsschemaorgofflineeventattendancemodeprivacylocation typepersoonlijke verhalenprice pricecurrency availabilitypricecurrency availabilitynbsp zeldzamehuidzorghttpswwwcmtcnleventsweeklyonmondays price pricecurrencyhttpswwwcmtcnleventsweeklyonmondays pricenullhandheld only screentype personurl httpswwwcmtcnleventsdailyeach3days pricepadding10px 0varjaarverslagentextaligncentereventstatusselectedwidth100 height100 positionabsolutebekijk detail context2019 presentatiestype placemarginbottom15px margintop0px marginright15pxmkbuttonhover colorffffff importantname weekly10pxnbsponderzoekscreen and maxwidth767pxeventattendancemode httpsschemaorgofflineeventattendancemodeurltop0cmtcbackgroundcolord1ac57socialopcmtcovmheight100 positionabsolute top0backgroundpositionleft top backgroundrepeatrepeatziekten organisaties3 daysmedia handheld onlydonateurmondays maandag bekijkbehandelingeventstatus httpsschemaorgeventscheduledcolorffffff important backgroundcolord1ac57switcherwereldwijdeswitcher selectedlaatstehttpswwwcmtcnleventsdailyeach3daysdays urlcommunitynacolorffffffminheight100pxtype place nameoffers url httpswwwcmtcnleventsweeklyonmondaysname daily eachperformer descriptionoffers urlvasculairefaqmalformatiesmediasirolimusovmpediaevent eventstatuspadding10pxurl httpswwwcmtcnleventsweeklyonmondays price20201007externeonlymkcolorlayer width100conferentiebackgroundpositionlefteventattendancemodemksvgicon colorffffff importanteenmondays url httpswwwcmtcnleventsweeklyonmondaysmedischecapillaire malformatiehttpsschemaorgofflineeventattendancemode location typemkbutton displayinlineblock maxwidth100cordlocationhetpositionabsolute top0 left0place name imagewijsocialnetworks55type eventmogelijke complicaties0 10pxdisplayinlineblockonline communitylees meerbekijkuwtextaligncenter important2person namemalformatiefunctionaddress organizer typeorganisatieonze organisatievrijwilligersyouvan onzepatintbackgroundpositionleft topproclaimerziektenmarginbottom15px margintop0pxaddressorganizercapillaireimage name dailyhttpswwwcmtcnleventsweeklyonmondaysdisplayinlineblock maxwidth100switcher optiondaily each 3price pricecurrencymeer nbsp zeldzamepermkbuttonhover colorffffff2019 presentaties eurordisaddress organizercontextsolidimportantplacemaxwidth767pxorganizer typeimportant backgroundcolord1ac57ifontstyleinherit media handheldonzemkbuttonhover mksvgiconfullwidth52spanzeldzamedescriptioneventattendancemode httpsschemaorgofflineeventattendancemode locationpadding10px 0 10pxhttpswwwcmtcnleventsdailyeach3days price pricecurrencyofferspresentatiesleeshttpsschemaorginstockmarginbottom15pximage name weeklymondays urlhttpswwwcmtcnleventsdailyeach3days price3width100 height100positionabsolutewidth100mkbutton48handheld onlylasertype event eventstatuslocation type placemedisch adviespersoonlijkemarginbottom0pxifontstyleinherit mediaonly screenpagesectioncontent padding10pxstartdatejouwdailyfalseover onze organisatiegegevensheight100 positionabsoluteperformer description imageurl offers urlmarginbottom0px textaligncenternieuwsbrieftop backgroundrepeatrepeatcomplicatiesoptionjqueryswitcheroffers url httpswwwcmtcnleventsdailyeach3daysifontstyleinheritname image addressfoldersamenwerkinghttpsschemaorgofflineeventattendancemode locationimage addresslohuizenpositionabsolute top0event eventstatus httpsschemaorgeventscheduledomgevingrechtentypemkbutton38fancytitle56liddiagnoseeventminheight100px marginbottom0pxwordtopvoorenddatepricecurrencyexterne conferentiesvrijwilligerweeklymargintop0pxmarginright15pxwereldwijde nonprofitnbsp zeldzame ziektensocial medianame url offersmkbuttonhoveralshemangioomover onzename dailynamevasculaire malformatiespersonmondays maandagspan ifontstyleinheritbekijk detailmkbutton7mkcolorlayer width100 height100daily eachdivider30diagnosismondayshttpschemaorg type eventwebsitesahoverbegeleidingimage address organizerfamiliedagenmkbutton53nederlandje51organisatiesmkbuttonhover mksvgicon colorffffffpsychologieadvieshttpsschemaorgeventscheduled startdatehttpsschemaorgeventschedulednonprofittop0 left0sponsor onzeveiligegeneticameervan onze organisatiepricecurrency availability httpsschemaorginstockdescription imagevalidfromfullwidth21organizer type personmogelijkebackgroundrepeatrepeateventstatus httpsschemaorgeventscheduled startdateledenbegrotingperformerscreenmkbutton backgroundcolorfad869overvanmkbutton25bijpagesectioncontent padding10px 0twittereach 3 dayswordendivider5patintenimage namemaandag bekijkconferentiescenterspan ifontstyleinherit mediaweekly on mondaysurl offerscontext httpschemaorg typehttpsschemaorginstock validfromverhalencontacthttpschemaorgname urlmargintop0px marginright15pxhandheldloop14aanlaatste nieuwseachsponsorslymphedemameer nbspmkbutton displayinlineblockfancytitle54stemmet0evenementenoverigemkbuttonsponsornieuwsurl httpswwwcmtcnleventsweeklyonmondayszeldzame ziektenmedischonlineavailabilitydaysinformatiepresentaties eurordismedia handheldmaxwidth100place nameactiviteitencontext httpschemaorgtype person nameregistratiebackgroundcolorfad869mkcolorlayerontwikkelingavailability httpsschemaorginstock validfromlees meer nbspname image

Longtail Keyword Density for Cmtcovm-no.org

KeywordsOccurences
daily each 316
each 3 days16
span ifont-styleinherit media14
media handheld only14
handheld only screen14
screen and max-width767px14
ifont-styleinherit media handheld14
type event eventstatus12
type person name12
context httpschemaorg type12
description image name12
performer description image12
availability httpsschemaorginstock validfrom12
pricecurrency availability httpsschemaorginstock12
event eventstatus httpsschemaorgeventscheduled12
httpschemaorg type event12
name url offers12
person name url12
price pricecurrency availability12
organizer type person12
type place name12
eventstatus httpsschemaorgeventscheduled startdate12
address organizer type12
eventattendancemode httpsschemaorgofflineeventattendancemode location12
httpsschemaorgofflineeventattendancemode location type12
location type place12
url offers url12
place name image12
image address organizer12
name image address12
detail context httpschemaorg10
bekijk detail context10
httpswwwcmtcnleventsdaily-each-3-days price pricecurrency8
3 days url8
days url httpswwwcmtcnleventsdaily-each-3-days8
image name daily8
offers url httpswwwcmtcnleventsdaily-each-3-days8
url httpswwwcmtcnleventsdaily-each-3-days price8
name daily each8
lees meer nbsp7
mk-buttonhover colorffffff important6
mk-button displayinline-block max-width1006
margin-bottom15px margin-top0px margin-right15px6
colorffffff important background-colord1ac576
mk-buttonhover mk-svg-icon colorffffff6
mk-svg-icon colorffffff important6
weekly on mondays6
page-section-content padding10px 05
padding10px 0 10px5
mk-color-layer width100 height1005
width100 height100 positionabsolute5
height100 positionabsolute top05
positionabsolute top0 left05
maandag bekijk detail4
nbsp zeldzame ziekten4
2019 presentaties eurordis4
background-positionleft top background-repeatrepeat4
van onze organisatie3
mondays maandag bekijk3
image name weekly3
httpswwwcmtcnleventsweekly-on-mondays price pricecurrency3
url httpswwwcmtcnleventsweekly-on-mondays price3
offers url httpswwwcmtcnleventsweekly-on-mondays3
over onze organisatie3
meer nbsp zeldzame3
mondays url httpswwwcmtcnleventsweekly-on-mondays3
url httpswwwcmtcnleventsdaily-each-3-days16
3 days16
each 316
daily each16
handheld only14
text-aligncenter important14
media handheld14
ifont-styleinherit media14
only screen14
span ifont-styleinherit14
address organizer12
type person12
image address12
person name12
name url12
place name12
url offers12
organizer type12
availability httpsschemaorginstock12
offers url12
location type12
price pricecurrency12
pricecurrency availability12
httpsschemaorginstock validfrom12
performer description12
description image12
image name12
bekijk detail12
type place12
name image12
httpsschemaorgofflineeventattendancemode location12
httpschemaorg type12
zeldzame ziekten12
eventattendancemode httpsschemaorgofflineeventattendancemode12
context httpschemaorg12
colorffffff important12
type event12
event eventstatus12
eventstatus httpsschemaorgeventscheduled12
httpsschemaorgeventscheduled startdate12
detail context10
lees meer10
name daily8
httpswwwcmtcnleventsdaily-each-3-days price8
days url8
meer nbsp7
onze organisatie7
url httpswwwcmtcnleventsweekly-on-mondays6
mk-buttonhover mk-svg-icon6
important background-colord1ac576
mk-svg-icon colorffffff6
mk-button background-colorfad8696
mk-buttonhover colorffffff6
presentaties eurordis6
displayinline-block max-width1006
mk-button displayinline-block6
margin-top0px margin-right15px6
social media6
margin-bottom15px margin-top0px6
padding10px 05
top0 left05
positionabsolute top05
height100 positionabsolute5
width100 height1005
mk-color-layer width1005
0 10px5
margin-bottom0px text-aligncenter5
min-height100px margin-bottom0px5
page-section-content padding10px5
nbsp zeldzame4
mogelijke complicaties4
capillaire malformatie4
ziekten organisaties4
2019 presentaties4
externe conferenties4
medisch advies4
switcher selected4
maandag bekijk4
switcher option4
top background-repeatrepeat4
background-positionleft top4
httpswwwcmtcnleventsweekly-on-mondays price3
wereldwijde non-profit3
name weekly3
over onze3
online community3
persoonlijke verhalen3
mondays url3
mondays maandag3
laatste nieuws3
van onze3
vasculaire malformaties3
sponsor onze3
name36
url36
type36
important33
image24
onze22
media20
text-aligncenter19
span18
017
httpswwwcmtcnleventsdaily-each-3-days16
each16
daily16
days16
switcher15
ziekten14
van14
ifont-styleinherit14
only14
screen14
max-width767px14
handheld14
114
cmtc14
startdate13
event13
zeldzame13
enddate13
meer12
context12
price12
malformatie12
availability12
offers12
mk-button12
person12
eventstatus12
httpsschemaorginstock12
organizer12
eventattendancemode12
organisatie12
httpschemaorg12
httpsschemaorgofflineeventattendancemode12
description12
httpsschemaorgeventscheduled12
place12
bekijk12
location12
address12
een12
detail12
mk-buttonhover12
performer12
colorffffff12
validfrom12
pricecurrency12
lees10
patint10
twitter10
margin-bottom0px10
presentaties10
conferenties9
eurordis9
met9
organisaties8
nbsp8
ovm8
registratie8
als8
background-colorfad8698
folder8
privacy7
vasculaire7
sponsor7
jqueryswitcher7
patinten7
overige7
persoonlijke7
nederland7
26
aan6
0386
het6
op6
36
social6
httpswwwcmtcnleventsweekly-on-mondays6
selected6
mk-svg-icon6
background-colord1ac576
top06
function6
mogelijke6
max-width1006
displayinline-block6
capillaire6
margin-right15px6
behandeling6
margin-top0px6
margin-bottom15px6
psychologie6
medische6
wij6
weekly6
activiteiten6
medisch6
faq6
mondays6
leden6
height1005
mk-button-485
mk-button-435
mk-button-385
mk-button-255
uw5
min-height100px5
positionabsolute5
page-section-content5
padding10px5
10px5
background-repeatrepeat5
mk-color-layer5
mk-button-75
width1005
left05
mk-button-535
vrijwilliger5
community5
nieuws5
wereldwijde5
malformaties5
option5
center5
null5
jouw5
samenwerking4
cord4
informatie4
full-width-524
evenementen4
huid4
laser4
externe4
diagnosis4
top4
background-positionleft4
websites4
na4
zorg4
rechten4
stem4
diagnose4
european4
genetica4
lid4
2020-09-284
hemangioom4
have4
ahover4
cmtc-ovm4
vrijwilligers4
solid4
full-width-214
begroting4
var4
begeleiding4
deelname4
pedia4
complicaties4
per4
advies4
donateur4
maandag4
voor4
social-networks-553
fancy-title-563
false3
loop-143
divider-53
divider-303
omgeving3
lohuizen3
43
fancy-title-543
nieuwsbrief3
non-profit3
sponsors3
veilige3
gegevens3
proclaimer3
jaarverslagen3
contact3
over3
online3
conferentie3
onderzoek3
word3
ontwikkeling3
verhalen3
familiedagen3
2020-10-073
53
worden3
hebben3
lymphedema3
you3
laatste3
bij3
sirolimus3
je3

Cmtcovm-no.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Cmtcovm-no.org is a scam?

Websites with Similar Names

Cmtco.com
Timing Pulleys & Keyless Locking Devices - Custom Machine and Tool
Cmtcollectibles.com
Welcome to CMT Collectibles - CMT Collectibles
Cmtconnect.org
CMT-Connect Online Essential Oil Webinar March 8, 2017
Cmtconstructionllc.net
CMT Construction, LLC - FREE Estimates | Sturgeon, MO
Cmtcorporativo.com
Inicio - Grupo CMT
Cmtcovm-de.org
Home - CMTC-OVM
Cmtcovm-nl.org
Home - CMTC-OVM
Cmtcovm-no.org
Home - CMTC-OVM

Recently Updated Websites

Fauntelle.com 1 second ago.Retractablestairs.com 2 seconds ago.Seoliverpool.com 2 seconds ago.Osmanliproje.com.tr 2 seconds ago.Iloveyou999.com 3 seconds ago.Directoryfordesigners.com 4 seconds ago.Planete-energies.com 4 seconds ago.Digitalawminute.net 5 seconds ago.Culturapollensa.com 5 seconds ago.Confraphael.com 6 seconds ago.Alldopromotion.com 6 seconds ago.Digitizedworld.net 6 seconds ago.Aviationancestry.com 6 seconds ago.Formationdepanneur.com 8 seconds ago.Whitebet.com 8 seconds ago.Koladeolamideayodeji.com 9 seconds ago.Podhost.de 10 seconds ago.U3asunshine.org.au 10 seconds ago.Maireaddambruch.com 11 seconds ago.Lakers.com 11 seconds ago.Aneme.pt 11 seconds ago.Vacaturesnl.com 13 seconds ago.Unternehmerindieschulen.de 13 seconds ago.Dav.de 13 seconds ago.Endwhiteprivilege.com 14 seconds ago.Org25.ru 14 seconds ago.Goldarrowconsulting.com 15 seconds ago.Tiffanycookevents.com 15 seconds ago.Iofa.org 15 seconds ago.Moulinderenty.com 16 seconds ago.