Collateralmurder.org Favicon Collateralmurder.org

Collateralmurder.org Website Thumbnail
Checking...
Collateral Murder
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
collateralmurder
Domain extension
org
Domain registered:
2010-03-27
Domain updated:
2020-10-12
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is collateralmurder.org ranked relative to other sites:

Percentage of visits to collateralmurder.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Collateralmurder.org registered?
A: Collateralmurder.org was registered 10 years, 6 months, 4 weeks, 1 day, 3 hours, 2 minutes, 50 seconds ago on Saturday, March 27, 2010.
Q: When was the WHOIS for Collateralmurder.org last updated?
A: The WHOIS entry was last updated 1 week, 6 days, 3 hours, 2 minutes, 50 seconds ago on Monday, October 12, 2020.
Q: What are Collateralmurder.org's nameservers?
A: DNS for Collateralmurder.org is provided by the following nameservers:
  • ns2.wikileaks.org
  • ns1.wikileaks.org
Q: Who is the registrar for the Collateralmurder.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Collateralmurder.org?
A: Collateralmurder.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Collateralmurder.org each day?
A: Collateralmurder.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Collateralmurder.org resolve to?
A: Collateralmurder.org resolves to the IPv4 address 185.165.168.41.
Q: In what country are Collateralmurder.org servers located in?
A: Collateralmurder.org has servers located in the Seychelles.
Q: What webserver software does Collateralmurder.org use?
A: Collateralmurder.org is powered by Nginx webserver.
Q: Who hosts Collateralmurder.org?
A: Collateralmurder.org is hosted by Fara Negar Pardaz Khuzestan in Seychelles.
Q: How much is Collateralmurder.org worth?
A: Collateralmurder.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Collateralmurder.org?

Collateralmurder.org Hosting Provider Information

Hosted IP Address:185.165.168.41
Hosted Hostname:wikileaks.org
Service Provider:Fara Negar Pardaz Khuzestan
Hosted Country:SeychellesSC
Location Latitude:-4.5834
Location Longitude:55.6667
Webserver Software:nginx

Is "Fara Negar Pardaz Khuzestan" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Collateralmurder.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Mon, 12 Oct 2020 01:30:31 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Last-Modified: Sun, 24 Jan 2016 00:33:35 GMT
Content-Encoding: gzip
Vary: Accept-Encoding
X-Cache: 0
Content-Type-Options: nosniff
X-XSS-PROTECTION: 1; mode=block
Cache-Control: public, must-revalidate, max-age=86400
Pragma: cache
Accept-Ranges: bytes
Strict-Transport-Security: max-age=31536000; includeSubDomains; preload

Collateralmurder.org Domain Nameserver Information

HostIP AddressCountry
ns2.wikileaks.org 46.28.206.82
ns1.wikileaks.org 46.28.206.81


Need to find out who hosts Collateralmurder.org?


WhoIs information for Collateralmurder.org

 Domain Name: COLLATERALMURDER.ORG
Registry Domain ID: D158708626-LROR
Registrar WHOIS Server: whois.dynadot.com
Registrar URL: http://www.dynadot.com
Updated Date: 2014-04-22T12:34:00Z
Creation Date: 2010-03-27T05:53:40Z
Registry Expiry Date: 2024-03-27T05:53:40Z
Registrar Registration Expiration Date:
Registrar: Dynadot, LLC
Registrar IANA ID: 472
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.6502620100
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization:
Registrant State/Province:
Registrant Country: KE
Name Server: NS1.WIKILEAKS.ORG
Name Server: NS2.WIKILEAKS.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-10-12T01:29:18Z

Collateralmurder.org Free SEO Report

Website Inpage Analysis for Collateralmurder.org

H1 Headings

3 :
  1. Submit documents to WikiLeaks
  2. WikiLeaks
  3. Collateral Murder

H2 Headings

2 :
  1. Mail subscription
  2. Overview

H3 Headings

11 :
  1. Contact
  2. Tor
  3. Tips
  4. After
  5. Follow us on Twitter!
  6. Check our Reddit!
  7. Digg this page!
  8. Twitter this!
  9. Short version
  10. Full version
  11. WikiLeaks' Collateral Murder: U.S. Soldier Ethan McCord's Eyewitness Story

H4 Headings

8 :
  1. Tails
  2. 1. Contact us if you have specific problems
  3. 2. What computer to use
  4. 3. Do not talk about your submission to others
  5. 1. Do not talk about your submission to others
  6. 2. Act normal
  7. 3. Remove traces of your submission
  8. 4. If you face legal action

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

3 :

Total Images

10 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

7:
  1. Overview
    http://collateralmurder.org/en/index.html
  2. Download
    http://collateralmurder.org/en/download.html
  3. Stills
    http://collateralmurder.org/en/stills.html
  4. Timeline
    http://collateralmurder.org/en/timeline.html
  5. Transcript
    http://collateralmurder.org/en/transcript.html
  6. Resources
    http://collateralmurder.org/en/resources.html
  7. Contact
    http://collateralmurder.org/en/contact.html

Links - Internal (nofollow)

0:

Links - Outbound

30:
  1. https://wikileaks.org/talk
    https://wikileaks.org/talk
  2. Tor
    https://www.torproject.org
  3. Tails
    https://tails.boum.org
  4. https://www.couragefound.org
    https://www.couragefound.org
  5. Verify
    https://wikileaks.org/verify-upload-address.txt
  6. WikiLeaks
    https://wikileaks.org
  7. Shop
    https://wikileaks.shop/
  8. Donate
    https://shop.wikileaks.org/donate
  9. Leaks
    https://wikileaks.org/-Leaks-.html
  10. News
    https://wikileaks.org/-News-.html
  11. About
    https://wikileaks.org/What-is-WikiLeaks.html
  12. Partners
    https://wikileaks.org/-Partners-.html
  13. our.wikileaks.org
    https://our.wikileaks.org
  14. Tor Project
    https://www.torproject.org/
  15. Tails
    https://tails.boum.org/
  16. Courage
    https://www.couragefound.org/
  17. Bitcoin
    https://www.bitcoin.org/
  18. No text
    https://www.facebook.com/wikileaks
  19. No text
    https://twitter.com/wikileaks
  20. No text
    http://wikileaks.org/
  21. Support
    http://wikileaks.ch/support.html
  22. Follow us on Twitter!
    http://twitter.com/wikileaks
  23. Check our Reddit!
    http://en.reddit.com/domain/wikileaks.org
  24. Digg this page!
    http://digg.com/submit?url=http%3A//collateralmurder.com/
  25. Twitter this!
    http://twitter.com/home?status=Reading%20http%3A//collateralmurder.com/
  26. WL Research Community - user contributed research based on documents published by WikiLeaks.
    https://our.wikileaks.org
  27. Tor is an encrypted anonymising network that makes it harder to intercept internet communications, or see where communications are coming from or going to.
    https://www.torproject.org/
  28. Tails is a live operating system, that you can start on almost any computer from a DVD, USB stick, or SD card. It aims at preserving your privacy and anonymity.
    https://tails.boum.org/
  29. The Courage Foundation is an international organisation that supports those who risk life or liberty to make significant contributions to the historical record.
    https://www.couragefound.org/
  30. Bitcoin uses peer-to-peer technology to operate with no central authority or banks; managing transactions and the issuing of bitcoins is carried out collectively by the network.
    https://www.bitcoin.org/

Links - Outbound (nofollow)

0:

Keyword Cloud for Collateralmurder.org

dataif younosubmissionwellif you havesourcehighriskmilitaryverywikileaks haswererisksecureoperating systempgpincidentmayusemakesystemhas releasedwe recommendjournalistsoperatingwhichrulestipsdo notsubmission systemyoureutersdvdpubliccouragehighrisk sourcecomplexkilleddoinghelpcomputernewstips for sourcesdoglobaladvisesticknetworksourcesavailableyoursources after submittingorganisationsreleasedcontact uswikileaksexperiencewikileaks has releasedanonymisingmurdercan alsocontact wikileakscontactusingyou cantortor tipsiftailsusb stickyou haveanysources afterkeycommunicationsbrowservideodocumentsusbthroughcanthoseevenseeusmediainternetprotectionparticularotherafter submittingtracesyour submissionsubmittinghasalsohardrecommendouraftertalknotweinformationlargeversiontheirhave

Longtail Keyword Density for Collateralmurder.org

KeywordsOccurences
tips for sources7
sources after submitting6
if you have4
wikileaks has released3
if you14
you can9
contact wikileaks8
after submitting7
your submission7
sources after6
you have6
tor tips6
do not5
high-risk source4
wikileaks has3
can also3
contact us3
usb stick3
operating system3
submission system3
we recommend3
has released3
you36
wikileaks24
tor20
if17
your14
submission13
contact13
after13
have12
can11
we9
computer9
our9
not8
submitting8
tips8
system8
sources8
us8
do7
tails7
source7
were7
use7
also6
media6
reuters5
any5
documents5
information5
using5
video5
talk4
stick4
even4
their4
high-risk4
has4
military4
traces4
usb4
communications4
public4
other4
journalists4
through4
available3
make3
courage3
anonymising3
recommend3
operating3
news3
murder3
released3
data3
help3
key3
no3
pgp3
version3
killed3
incident3
rules3
may3
particular3
hard3
see3
very3
large3
complex3
risk3
which3
experience3
browser3
secure3
doing3
internet3
global3
protection3
those3
well3
advise3
network3
dvd3
organisations3

Collateralmurder.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Collateralmurder.org is a scam?

Websites with Similar Names

Colla-cinque.com
| Colla Cinque | 西宮市甲子園五番町
Colla-voce.com
Web Hosting Parking Page
Colla.xyz
colla.xyz - colla Resources and Information.
Colla21nord.com
Untitled Document
Collaaj.com
Video Platform For Enterprise & Education - Powerful Capture & Sharing
Collab-collective.xyz
collab-collective.xyz - Registered at Namecheap.com
Collab-creation.com
HugeDomains.com - Shop for over 300,000 Premium Domains
Collab-garage.com
Félicitations ! Votre domaine a bien été créé chez OVH !
Collab-it.net
collabit(コラビット)|不動産テック(RealEstateTech)企業

Recently Updated Websites

Kialectics.com 2 seconds ago.Tootington.com 2 seconds ago.Unitedveteransconstruction.com 3 seconds ago.Rabbiwarwick.com 3 seconds ago.Collegedebrink.nl 3 seconds ago.Caseyclassiccars.com 4 seconds ago.Photoworkshops.de 4 seconds ago.Kleankixs.com 5 seconds ago.Cryotherapytempe.com 6 seconds ago.Fullertonrealestateagents.com 6 seconds ago.Jiudingco.com 6 seconds ago.Catclinicoffolsom.com 6 seconds ago.Zuutv.com 7 seconds ago.Modekit.com 7 seconds ago.Gemar.org 7 seconds ago.Gruendlers-dental.de 7 seconds ago.Rootcreation.com 8 seconds ago.Diark.org 8 seconds ago.Premierfoods.co.uk 8 seconds ago.Greenbergco.com 9 seconds ago.Childcare-information.net 9 seconds ago.Basenjipuppy.com 9 seconds ago.Blackonblackcrimedeserayjuelz.com 9 seconds ago.Clic-shop.de 10 seconds ago.Status-motoring.com 10 seconds ago.Usmsg.org 10 seconds ago.Knologybusiness.com 10 seconds ago.Campoceanpines.org 10 seconds ago.1000fatpeople.com 11 seconds ago.Caravanstickers.com 11 seconds ago.