Compegps.es

Checking...
TwoNav: gps, mapas y software para senderismo, mtb, ciclismo ...
Low trust score
Add a review Change category Claim this site
Encuentra el GPS, mapa o software perfecto para tu deporte o actividad al aire libre: senderismo, mtb, ciclismo, trail running…


Domain summary

Domain label
compegps
Domain extension
es
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is compegps.es ranked relative to other sites:

Percentage of visits to compegps.es from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Compegps.es registered?
A: Compegps.es was registered 1 week, 5 days, 13 hours, 58 minutes, 34 seconds ago on Friday, September 11, 2020.
Q: When was the WHOIS for Compegps.es last updated?
A: The WHOIS entry was last updated 1 week, 5 days, 13 hours, 58 minutes, 34 seconds ago on Friday, September 11, 2020.
Q: Who is the registrar for the Compegps.es domain?
A: The domain has been registered at .
Q: What is the traffic rank for Compegps.es?
A: Compegps.es has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Compegps.es each day?
A: Compegps.es receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Compegps.es resolve to?
A: Compegps.es resolves to the IPv4 address 213.186.33.5.
Q: In what country are Compegps.es servers located in?
A: Compegps.es has servers located in the France.
Q: What webserver software does Compegps.es use?
A: Compegps.es is powered by Nginx/1.10.3 webserver.
Q: Who hosts Compegps.es?
A: Compegps.es is hosted by OVH SAS in France.
Q: How much is Compegps.es worth?
A: Compegps.es has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Compegps.es?

Compegps.es Hosting Provider Information

Hosted IP Address:213.186.33.5
Hosted Hostname:redirect.ovh.net
Service Provider:OVH SAS
Hosted Country:FranceFR
Location Latitude:48.8582
Location Longitude:2.3387
Webserver Software:nginx/1.10.3

Is "" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Compegps.es

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Accept-Ranges: bytes
Age: 0
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0, max-age=60, private, proxy-revalidate, no-cache="set-cookie"
Content-Encoding: gzip
Content-Type: text/html; charset=UTF-8
Date: Fri, 11 Sep 2020 17:21:51 GMT
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Pragma: no-cache
Server: nginx/1.10.3
Vary: Accept-Encoding
Via: 1.1 varnish (Varnish/5.0)
X-Content-Type-Options: nosniff
X-Frame-Options: SAMEORIGIN
X-Varnish: 7825851
X-XSS-Protection: 1; mode=block
Content-Length: 31894
Connection: keep-alive

Compegps.es Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Compegps.es?


WhoIs information for Compegps.es

Compegps.es Free SEO Report

Website Inpage Analysis for Compegps.es

H1 Headings

2 :
  1. Cuando la Seguridad en la Orientación outdoor realmente Importa
  2. Descubre cómo TwoNav se adapta a tu actividad outdoor

H2 Headings

9 :
  1. No tiene artículos en su carrito de compras.
  2. Productos Destacados
  3. Consigue la mejor Ruta
  4. Disfruta tu Actividad
  5. Analiza y comparte tus mejores Experiencias
  6. Los proveedores de Cartografía más importantes
  7. Preparación avanzada de itinerarios con Land
  8. Descubre más y mantente al día con TwoNav
  9. Comparte tu experiencia #FreedomToDiscover

H3 Headings

7 :
  1. NOVEDADES
  2. GPS Multideporte
  3. Excursionismo
  4. Ciclismo
  5. Vuelo libre
  6. Motor
  7. Servicios Profesionales

H4 Headings

14 :
  1. Cerrar
  2. Eliminar elemento
  3. Eliminar Método de pago
  4. Aventura 2
  5. Trail 2
  6. Trail 2 Bike
  7. Land
  8. Gran combinación de GPS, software de navegación premium y la más amplia colección de mapas para preparar tus rutas y disfrutarlas de manera segura
  9. Jesús Calleja, nuevo embajador de TwoNav
  10. ¡Próximamente nuevo TwoNav Challenge!
  11. App Link, ahora también disponible para Android
  12. Regístrate al newsletter de TwoNav y recibe ventajas exclusivas
  13. Gracias por registrarte a nuestra newsletter. A partir de este momento serás el primero en recibir cualquier novedad de TwoNav.
  14. ¿Necesitas ayuda?

H5 Headings

19 :
  1. GPS Navegación Outdoor
  2. Servicios
  3. Tutoriales
  4. Outlet
  5. Packs Nuevo
  6. Software
  7. Apps
  8. Servicios
  9. Tutoriales
  10. Packs NUEVO
  11. Sobre nosotros
  12. Embajadores
  13. Soporte
  14. Blog
  15. Aventura 2 Challenge
  16. Trail 2 Challenge
  17. 9 de octubre de 2020
  18. 9 de septiembre de 2020
  19. 13 de agosto de 2020

H6 Headings

2 :
  1. Por Modelo
  2. Por Deporte

Total IFRAMEs

1 :

Total Images

33 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-32769126-1

Links - Internal

53:
  1. GPS
    http://compegps.es/es/gps
  2. Todos los dispositivos
    http://compegps.es/es/gps
  3. Aventura 2 Nuevo
    http://compegps.es/es/gps/aventura-2
  4. Aventura 2 Motor Nuevo
    http://compegps.es/es/gps/aventura-2-motor
  5. Trail 2
    http://compegps.es/es/gps/trail-2
  6. Trail 2 Bike
    http://compegps.es/es/gps/trail-2-bike
  7. Horizon
    http://compegps.es/es/gps/horizon
  8. Horizon Bike
    http://compegps.es/es/gps/horizon-bike
  9. Velo
    http://compegps.es/es/gps/velo
  10. Comparar dispositivos
    http://compegps.es/es/comparar-gps
  11. Excursionismo
    http://compegps.es/es/excursionismo
  12. Ciclismo
    http://compegps.es/es/ciclismo
  13. Vuelo Libre
    http://compegps.es/es/vuelo-libre
  14. Motor
    http://compegps.es/es/motor
  15. Outlet
    http://compegps.es/es/outlet
  16. Packs Nuevo
    http://compegps.es/es/packs
  17. Packs
    http://compegps.es/es/packs
  18. Land
    http://compegps.es/es/software/land
  19. Air
    http://compegps.es/es/software/air
  20. TwoNav Premium App
    http://compegps.es/es/software/app
  21. TwoNav Link App Nuevo
    http://compegps.es/es/software/link
  22. Packs NUEVO
    http://compegps.es/es/packs
  23. Premium App
    http://compegps.es/es/software/app
  24. Link App Nuevo
    http://compegps.es/es/software/link
  25. Compañía
    http://compegps.es/es/sobre-nosotros
  26. Partners
    http://compegps.es/es/partners
  27. Contacto
    http://compegps.es/es/donde-estamos
  28. Embajadores TwoNav
    http://compegps.es/es/embajadores
  29. Conviértete en Embajador
    http://compegps.es/es/conviertete_embajador
  30. Manuales
    http://compegps.es/es/manuales
  31. Descargas
    http://compegps.es/es/descargas
  32. Descargar ahora
    http://compegps.es/es/link
  33. Your browser does not support HTML5 video. ¡Escoge el tuyo!
    http://compegps.es/es/packs
  34. Comprar ahora
    http://compegps.es/es/equipacion
  35. No text
    http://compegps.es/es/mapas
  36. Saber más
    http://compegps.es/es/mapas
  37. No text
    http://compegps.es/es/software/land
  38. Saber más
    http://compegps.es/es/software/land
  39. Ver más
    http://compegps.es/es/excursionismo
  40. Ver más
    http://compegps.es/es/ciclismo
  41. Ver más
    http://compegps.es/es/vuelo-libre
  42. Ver más
    http://compegps.es/es/motor
  43. Ver más
    http://compegps.es/es/servicios-profesionales
  44. recepción de ofertas exclusivas
    http://compegps.es/es/aceptacion-recepcion-ofertas-exclusivas
  45. Software
    http://compegps.es/es/software
  46. Mapas
    http://compegps.es/es/mapas
  47. Accesorios
    http://compegps.es/es/accesorios
  48. Equipación
    http://compegps.es/es/equipacion
  49. myTwoNav
    http://compegps.es/es/customer/account/create/
  50. Prensa
    http://compegps.es/es/sala-prensa
  51. Embajadores
    http://compegps.es/es/embajadores
  52. Trabaja con nosotros
    http://compegps.es/es/ofertas-de-trabajo
  53. Aviso Legal
    http://compegps.es/es/aviso-legal

Links - Internal (nofollow)

0:

Links - Outbound

38:
  1. más información
    https://www.enable-javascript.com/es/
  2. No text
    https://www.twonav.com/es/
  3. Accede
    https://www.twonav.com/es/customer/account/login/
  4. Regístrate
    https://www.twonav.com/es/customer/account/create/
  5. Mapas
    https://www.twonav.com/es/mapas
  6. Accesorios
    https://www.twonav.com/es/accesorios
  7. Equipación
    https://www.twonav.com/es/equipacion
  8. Ecosistema
    //ecosystem.twonav.com/ec/es/index.html
  9. Packs
    https://www.twonav.com/es/packs
  10. GO Cloud
    //go.twonav.com/es
  11. SeeMe
    //seeme.twonav.com/es/
  12. Tutoriales
    https://www.youtube.com/user/compegps
  13. Tutoriales
    https://www.youtube.com/playlist?list=PLi804nWnO7LbClbil-9_0_RZ22GweLUpj
  14. Atención al cliente
    //support.twonav.com/hc/es
  15. FAQs
    //support.twonav.com/hc/es/categories/115000067931-Preguntas-frecuentes
  16. Blog
    //blog.twonav.es
  17. Aventura 2 Challenge
    //aventura2challenge.twonav.com/es
  18. Trail 2 Challenge
    //trail2challenge.twonav.com/es
  19. No text
    https://www.facebook.com/TwoNav-International-201052116898988/
  20. No text
    https://twitter.com/twonav
  21. No text
    https://www.youtube.com/user/compegps
  22. No text
    https://www.instagram.com/twonav_official/
  23. No text
    https://www.linkedin.com/company/twonav
  24. 0
    https://www.twonav.com/es/checkout/cart/
  25. Leer más
    https://blog.twonav.com/es/jesus-calleja-nuevo-embajador-de-twonav/
  26. Leer más
    https://blog.twonav.com/es/proximamente-nuevo-twonav-challenge/
  27. Leer más
    https://blog.twonav.com/es/nueva-app-link-ya-disponible/
  28.  Seguir TwoNav en Instagram
    https://www.instagram.com/twonav_official/
  29. No text
    https://es-es.facebook.com/CompeGPS/
  30. No text
    https://twitter.com/twonav_es
  31. No text
    https://es.linkedin.com/company/twonav
  32. Contactar
    https://support.twonav.com/
  33. GO
    https://go.twonav.com
  34. SeeMe
    https://seeme.twonav.com
  35. Atención al cliente
    https://support.twonav.com
  36. FAQs
    https://support.twonav.com/hc/es
  37. Comunidad
    https://support.twonav.com/hc/es/community/topics
  38. Más información
    https://www.twonav.com/es/politica-de-cookies

Links - Outbound (nofollow)

0:

Keyword Cloud for Compegps.es

ulnavlinksifwcguaglobaltrackerenabledif gaundefinedpagevieweliminarparatrail 2goif typeoftypeof sparamspage undefinedquecloudaventura0go cloudshouldsendimpressionevent falsevartrailundefined eventname2 challengelasclickdispositivosclick functiongasend pageviewhorizonundefinedsparamspage iftucomprapremiumclick function eventnameporembajadoressparamspage if gaundefinedservicios go cloudgaundefinedtypeofeventname sparamspage ifnocerrarbikeeventnametypeof sparamspagecookiesif gaundefined gasendsuperioresfunctioncompras superioressparamspage undefinedundefined eventname sparamspagesparamspageserviciosgasend pageview eventnameservicios gotieneelsparamspage undefined eventnametimesaventura 2elementonuevogasendclientidfuncionamientocestafalseiftutorialesimpressiondatanavegadorgaundefined gasendmotorconeventname sparamspageif typeof sparamspagegaundefined gasend pageviewpacksappfunction eventnamepageview eventnamewebno tienetwonavchallengeshouldsendimpressioneventtruetu navegador1segurocompras

Longtail Keyword Density for Compegps.es

KeywordsOccurences
click function eventname3
if typeof sparamspage3
typeof sparamspage undefined3
sparamspage undefined eventname3
undefined eventname sparamspage3
eventname sparamspage if3
sparamspage if gaundefined3
if gaundefined gasend3
gaundefined gasend pageview3
gasend pageview eventname3
servicios go cloud3
aventura 26
trail 26
gasend pageview4
2 challenge4
compras superiores4
go cloud4
shouldsendimpressionevent false4
sparamspage undefined3
undefined eventname3
eventname sparamspage3
tu navegador3
if gaundefined3
gaundefined gasend3
pageview eventname3
typeof sparamspage3
if typeof3
servicios go3
function eventname3
click function3
no tiene3
sparamspage if3
var18
012
if10
eventname9
nuevo8
function8
tu7
aventura7
twonav6
sparamspage6
trail6
shouldsendimpressionevent6
no5
15
por5
compras5
eliminar5
que5
false5
true4
motor4
dispositivos4
horizon4
seguro4
go4
cloud4
tutoriales4
packs4
gasend4
superiores4
pageview4
app4
bike4
impressiondata4
para4
el4
funcionamiento4
cookies4
las4
challenge4
embajadores4
servicios3
ulnav-links3
times3
compra3
cesta3
elemento3
cerrar3
gaundefined3
undefined3
typeof3
click3
premium3
tiene3
web3
con3
navegador3
clientid3
ifwcguaglobaltrackerenabled3

Compegps.es Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Compegps.es is a scam?

Websites with Similar Names

Compe-propo.com
コンペプロポドットコム || 建築コンペ プロポーザル情報サイト
Compe-tic.org
403 Forbidden
Compeangroup.com
Real Estate in Houston | Expert and professional real estate assistance!
Compearethemarket.com
HugeDomains.com - Shop for over 300,000 Premium Domains
Compearit.com
This site is under development
Compeat.com
Compeat | The #1 Restaurant Management Software
Compeatnutrition.com
Compeat Nutrition
Compeaus.com
Compeau's – Your Fairbanks Powersports Dealer

Recently Updated Websites

Biyokulule.com 2 seconds ago.Sunzinet.com 2 seconds ago.Sys-manage.com 3 seconds ago.Businessofapps.com 3 seconds ago.Portal.artistintelligence.agency 4 seconds ago.Replaceme.net 5 seconds ago.Kungfurecords.com 5 seconds ago.Pdfpad.com 5 seconds ago.Ars-regendi.com 5 seconds ago.Themmabody.com 8 seconds ago.Jeppeboys.co.za 8 seconds ago.Chafeto.com 8 seconds ago.Tzechundance.com 9 seconds ago.Texnd.com 9 seconds ago.Nddac.org 11 seconds ago.Iphonepuebla.com 11 seconds ago.Bauformen-der-imagination.de 11 seconds ago.Kamacademy.com 12 seconds ago.Blacktgirls.com 12 seconds ago.Walkerzanger.com 12 seconds ago.Thienduongcacanh.com 12 seconds ago.Thetemeculastampede.com 13 seconds ago.Geekportland.com 13 seconds ago.Sailboatspares.com 14 seconds ago.Merrillinc.com 14 seconds ago.Argyllestateagents.com 15 seconds ago.Showmehome.com 15 seconds ago.Shoot-telegraph.xyz 16 seconds ago.Mdvinteractive.com 16 seconds ago.Patriciavalentino.com 17 seconds ago.