Constitution Society – Advocates and enforcers of the U.S. and State Constitutions

Safety: Low trust score
Year Founded: 1996
Global Traffic Rank: 15,802
Estimated Worth: $956,160



Domain summary

Last updated
2021-05-21
Domain label
constitution
Domain extension
org
Domain registered:
1996-06-02
Domain updated:
2021-05-21
Global Traffic Rank
15,802
Statvoo Rating
C
Trust Score
Low Trust Score
Estimated worth
$956,160
Estimated daily income
$1,328
Estimated monthly income
$40,393

Frequently Asked Questions (FAQ)

Q: When was Constitution.org registered?
A: Constitution.org was registered 25 years, 2 weeks, 23 hours, 14 minutes, 47 seconds ago on Sunday, June 2, 1996.
Q: When was the WHOIS for Constitution.org last updated?
A: The WHOIS entry was last updated 3 weeks, 5 days, 23 hours, 14 minutes, 47 seconds ago on Friday, May 21, 2021.
Q: What are Constitution.org's nameservers?
A: DNS for Constitution.org is provided by the following nameservers:
  • ns-185.awsdns-23.com
  • ns-1471.awsdns-55.org
Q: Who is the registrar for the Constitution.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Constitution.org?
A: Constitution.org ranks 15,802 globally on Alexa. Constitution.org has a Low Trust Score, and a Statvoo Rank of C.
Q: How many people visit Constitution.org each day?
A: Constitution.org receives approximately 110,692 visitors and 664,152 page impressions per day.
Q: What IP address does Constitution.org resolve to?
A: Constitution.org resolves to the IPv4 address .
Q: In what country are Constitution.org servers located in?
A: Constitution.org has servers located in the .
Q: What webserver software does Constitution.org use?
A: Constitution.org is powered by Nginx/1.16.0 webserver.
Q: Who hosts Constitution.org?
A: Constitution.org is hosted by Unknown in .
Q: How much is Constitution.org worth?
A: Constitution.org has an estimated worth of $956,160. An average daily income of approximately $1,328, which is roughly $40,393 per month.

Constitution.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Constitution.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Constitution.org

H1 Headings

1 :
  1. Opening Page

H2 Headings

0 :

H3 Headings

2 :
  1. Log in with your credentials
  2. Forgot your details?

H4 Headings

6 :
  1. Search Pages and Posts ONLY
  2. Search ENTIRE Site
  3. Login
  4. Recent Posts
  5. Recent Comments
  6. Site Statistics

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

5 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

97:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

1:

Keyword Cloud for Constitution.org

per ilimportantposition relativetyper av cookiesavbids bidder1000000 return adj2anytrue preload falsepodatakamomenturl goezodncomdetroitchicagospringfieldjscbdetroitchicagospringfieldjsezcookiedialog buttonpartenairesstraniil linkvonbidder amxdatoslawvar adj1ochquestoezcookietabledessapagebidder ix paramscookies somalsleftezfadpositionsieconsindix params siteidborderinformazioni chedisplayintedontwerdenparteexpiresfri 21alinosgumgum paramsbidder districtm5000 maxallowedvasttagredirects 3bidderrenderer urlaveclibrary of constitutionalezoicoutstreamplayerbid bidadunitcode configobjnone importantezcookiedialogwrapper ezcookiedialogdapossonoconfigobj widthbidosobneversionzxpvawmuy29t bidder rhythmonedulikesiteidrcatch eallowvpaidspletni straniif bidvastxmlpourlos sitiosnuestros sociosinformationenzijn voornotreilsullasocioscookies0solidtrattamento deiparagebruikusedetusparams inslotzijnle lienbidder rhythmone params5000 maxallowedvasttagredirectsbackuponly true bidsallowvpaid truedernostra217328 targetinguuidtry settimeoutvarlesdansonstheirmediatypesmaxallowedvasttagredirects 3 allowvpaidconfiguracinpreload falsetrattamentoconsensopathkojemedconsentimientoezoicoutstreamplayerbidimportantfontfamilyililes sitespersonligyouinterestfunctionbidcpm var adj1websitesinformationadtext062816textcolorimportantezcookiedialogwrapperrender function bidautoplay true preloadnastavitvedisplay flexsearchdatibid ifcursor pointer importantbackgroundnonevrste pikotkov16pxvfalseperh2solid transparentdoesntprovidevisualizzarekojiparams placementideenadj2 adj1 1000000oprelativenull try settimeoutvarprivatebidder gumgum paramsplacementid 10036575 biddertipipartnerjiadj1 1000000path domainconstitutionorg10pxdoorundefined bidvastxmlsito webpersoonlijkeufunctionbidcpmparams siteidutilizaifonzedes cookiescookiescookiedetailslinkcookie3000 catch evousprotectionsbidvastxml undefinedtrue preloadconfigobj 30003 allowvpaid truepersnlicheheightomquisontygenomsitotrue adtextadj1 1000000 returnamx paramspikotkovvasttimeout 5000 maxallowedvasttagredirectsbackuponlyhomemediatypes video contextoutstreamdomainconstitutionorg expiresfri 21function bidezcookiedialog ezcookietablepuedendatatagid zxpvawmuy29t bidderebidwidthimportanttextdecoration none importantezcookiedialogwrapperimportantpositioncatchdencomoif youmedialienfunction bid if12nostri11withoutcesocial mediaosebnemediatypes videomay 2021 062816importanttextdecorationtrue bidsunohnepasswordtipi di cookievoorwirhelfenweb siconstitutionsbidder amx paramsvasttimeout 5000persoonlijke informatiesitio webezcookiedialogwrapper ezcookiedialogbidheightil consensoesunsererrenderer url goezodncomdetroitchicagospringfieldjscbdetroitchicagospringfieldjslnken21 may 2021goezodncomdetroitchicagospringfieldjscbdetroitchicagospringfieldjs render3000 catchproveedoresanderefr attmarginnousbidder rhythmonejearial seriffalse truebidvastxml null10odiesesomrender5px7siteimportantfontfamily arialkunnendezesfuncplusvarstvuimportantwidtho varstvunai partneripath domainconstitutionorg expiresfrisites webspletnilas5genom attsonopara elezcookiedialog h2naedesnot20px importanttextdecorationum dielorobids bidder districtmbackuponly truefunctionbidcpm varinformacijeix paramstevar adj2 adj1rhythmoneimportantcolor textcolorimportantezcookiedialogwrapper6gebruiktsiteid 217328 targetinguuidknnenbelangtrattamento dei datisoortensiteid 217328publicmomentousebidvastxml undefined bidvastxmlpointerdie vonezcookieoptionlos sitios webpleasecuicontentboxbidwidth height bidheighthebbennull tryamximportantpaddinghjlpernewallowvpaid true autoplayvrparams tagid zxpvawmuy29tinformazioni personalitypesnuestraimportantmargintoptheyunruly paramsvideo contextoutstreamourquesto sitotyper avadj2 adj1districtm paramsbidadunitcodeplacementid 10036575personalivar217328 targetinguuid 217328undefinedanvnderconfidentialitadj1nos partenairesdomainconstitutionorgnostri partnerinformazionirhythmone params placementid21 maywidth bidwidth heightmute true adtextunrulymarketingtrue adtext ezoicoutstreamplayerbidellersitiostargetinguuidsitipos de cookiesvasttimeoututanvra partnersalsometrendering backuponly trueconfigobj width bidwidthdei250 renderer urldocumentwritesite weboderplacementid 215626nuestrostypes of cookiesclassicsservices3 allowvpaidcursor pointerlahkochepointer importantbackgrounddennainslotimportantfontfamily arial serifkolaiebidsinformatieimportantezcookiedialogwrapper ezcookiedialog ezcookietablelosomogoajoconstitutionalfrmute3functionspletnepartnerprinciplesour partnersarialtrue bids bidderselectwrapperdonnestargetinguuid 217328surzxpvawmuy29tcontainwedistrictmbidcpmadjustment4px solidparamsbid if bidvastxmlspletne straniconfigobj 3000 catchwienumbercatch e consolelogeconsolelogerrorcookieconsolelogeconsolelogerror in renderingurl goezodncomdetroitchicagospringfieldjscbdetroitchicagospringfieldjs renderpikotkiconsentementsoorten cookieslinkmoguparams placementid 10036575doautoplay truereturnsettimeoutvar configobjwebnone importantezcookiedialogwrappermaxallowedvasttagredirectsnoplacementidouezcookiedialoguwbidcpmadjustment functionbidcpmnaihtrue autoplay truekolaiinecesariassamtyckeprivacyelamx params tagid14postavkekolaiakancandistrictm params placementidgoezodncomdetroitchicagospringfieldjscbdetroitchicagospringfieldjs render function81pxzeducationtiposonze partnershavecursorrenderingdivgptadconstitutionorglargemobilebanner10bidder unrulydisocial12pxall10px 20pxdat10036575 bidder amxdes informationsezcookiedialog pbidwidth heighttagidu0026siti webbidheight vasttimeout 5000try settimeoutvar configobjihreezcookiedialogwrapper1params placementid 215626rightscomporta osuautoplaycontentezcookiedialog ezcookieoptionwordentrue truesitestrycodefalse functionurlimportanttextdecoration nonenecessaryautoeinigesettingssonbidadunitcode configobj 3000may 20212021 062816successtagid zxpvawmuy29tow ohspletnihatttextcolorimportantezcookiedialogwrapper ezcookiedialoginformacinutilisonsdelpolitique de confidentialitparams tagidledi cookiefalse mute truerenderernai partnerjidieserparams siteid 217328processgovernmentdateninputimportantfontsizenstatestipi dibidder districtm paramsflexqueav cookiestruewiltsettimeoutvar configobj widthimportantezcookiedialogwrappermakedei datisitiresponse215626 bidder ixseimportantcolor textcolorimportantezcookiedialogwrapper ezcookiedialoggumgum params inslotpreload false mutepodatkeadtext ezoicoutstreamplayerbid bidadunitcodeimportantdisplayvotrepte makentypernaivar adj1 bidcpmkotpolitiquedisplay none4reformumaanwidthlibraryfrnunruly params siteidsettimeoutvarezcookiedialog selectwrappernullbidvastxmlvrsteblockixtillcomeconstitutional classicszasitios web13goezodncomdetroitchicagospringfieldjscbdetroitchicagospringfieldjsn ncomportawebbplatsenbidheight vasttimeoutdinles sites webviimportantmargin20pximportantcolorwidth bidwidthwebsitegumgumvaeestewebmjestaif bidvastxml undefinedsizestateadj1 bidcpmadtext ezoicoutstreamplayerbid4pxserifpreload9fournisseursdiecookies diesharepersnliche informationenmakenbidcpmadjustment functionbidcpm vartrue autoplayow2namaxallowedvasttagredirects 3bidder gumgume consolelogeconsolelogerrorelitenavigationmayvradomainconstitutionorg expiresfrirender functionverwendetzuonlycookies quepartnerifalse mutehargliverwendenkivideoexpiresfri 21 maytrenutkuconfigobjpartnersuspstringtoutpodatkovncessaireswebmjestoinformacin personalgegevensimportantlineheightyourapplicableelsepersonalpropertyezoicoutstreamplayerbid bidadunitcodeuporabljamoplacementid 215626 bidderexpiresfrirhythmone paramsimportantbackgroundbidvastxml null tryinformationswebbplatserdueconstitutionspeichernauf1000000 returnmemorizzarerendering backuponlyundefined bidvastxml nullsolistabidadunitcode configobjheight bidheight vasttimeoutbasic10036575 bidderbidcpm250 rendererheight bidheightmediatypes bannerimportantheightconsolelogeconsolelogerrorcontextoutstreambidder unruly paramspeuventimportantezcookiedialogwrapper ezcookiedialogreturn adj2215626 bidderbannerpersonal informationzxpvawmuy29t biddervar adj2bidder ixsitiovanuspstring ntransparentbuttonmute trueinteresseconsenttoestemmingadj2rememberwebbplatscontain personal

Longtail Keyword Density for Constitution.org

KeywordsOccurences
none importantez-cookie-dialog-wrapper ez-cookie-dialog12
bidcpmadjustment functionbidcpm var7
functionbidcpm var adj17
var adj1 bidcpm7
var adj2 adj17
adj2 adj1 10000007
adj1 1000000 return7
1000000 return adj27
path domainconstitutionorg expiresfri6
importantfont-family arial serif6
expiresfri 21 may6
domainconstitutionorg expiresfri 216
21 may 20216
may 2021 0628164
gumgum params inslot4
bidder gumgum params4
ix params siteid4
bidder ix params4
215626 bidder ix4
placementid 215626 bidder4
params placementid 2156264
rhythmone params placementid4
bidder rhythmone params4
zxpvawmuy29t bidder rhythmone4
tagid zxpvawmuy29t bidder4
amx params tagid4
bidder amx params4
importantcolor textcolorimportantez-cookie-dialog-wrapper ez-cookie-dialog4
importanttext-decoration none importantez-cookie-dialog-wrapper4
params tagid zxpvawmuy29t4
rendering backuponly true3
backuponly true bids3
library of constitutional3
consolelogeconsolelogerror in rendering3
catch e consolelogeconsolelogerror3
3000 catch e3
configobj 3000 catch3
bidadunitcode configobj 30003
bidder unruly params3
ezoicoutstreamplayerbid bidadunitcode configobj3
adtext ezoicoutstreamplayerbid bidadunitcode3
true bids bidder3
trattamento dei dati3
unruly params siteid3
params siteid 2173283
siteid 217328 targetinguuid3
217328 targetinguuid 2173283
types of cookies3
politique de confidentialit3
les sites web3
tipos de cookies3
los sitios web3
tipi di cookie3
mute true adtext3
typer av cookies3
cursor pointer importantbackground3
true adtext ezoicoutstreamplayerbid3
bidheight vasttimeout 50003
false mute true3
250 renderer url3
bid if bidvastxml3
function bid if3
render function bid3
goezodncomdetroitchicagospringfieldjscbdetroitchicagospringfieldjs render function3
url goezodncomdetroitchicagospringfieldjscbdetroitchicagospringfieldjs render3
renderer url goezodncomdetroitchicagospringfieldjscbdetroitchicagospringfieldjs3
mediatypes video contextoutstream3
bidvastxml undefined bidvastxml3
10036575 bidder amx3
placementid 10036575 bidder3
params placementid 100365753
districtm params placementid3
bidder districtm params3
bids bidder districtm3
if bidvastxml undefined3
undefined bidvastxml null3
preload false mute3
5000 maxallowedvasttagredirects 33
true preload false3
autoplay true preload3
true autoplay true3
allowvpaid true autoplay3
3 allowvpaid true3
maxallowedvasttagredirects 3 allowvpaid3
vasttimeout 5000 maxallowedvasttagredirects3
bidvastxml null try3
height bidheight vasttimeout3
bidwidth height bidheight3
width bidwidth height3
configobj width bidwidth3
settimeoutvar configobj width3
try settimeoutvar configobj3
null try settimeoutvar3
importantez-cookie-dialog-wrapper ez-cookie-dialog ez-cookie-table3
importantez-cookie-dialog-wrapper ez-cookie-dialog39
none importantez-cookie-dialog-wrapper12
ez-cookie-dialog-wrapper ez-cookie-dialog11
fr att9
sitio web8
params placementid8
bids bidder8
ez-cookie-dialog ez-cookie-table8
var adj27
bidcpmadjustment functionbidcpm7
adj1 10000007
1000000 return7
return adj27
adj1 bidcpm7
arial serif7
var adj17
may 20217
adj2 adj17
functionbidcpm var7
params siteid7
site web7
path domainconstitutionorg7
cookies die6
sito web6
importantfont-family arial6
domainconstitutionorg expiresfri6
expiresfri 216
21 may6
textcolorimportantez-cookie-dialog-wrapper ez-cookie-dialog5
mediatypes banner5
importanttext-decoration none5
cookies que4
nos partenaires4
nuestros socios4
spletne strani4
spletni strani4
2021 0628164
sites web4
per il4
nostri partner4
des cookies4
los sitios4
true true4
if you4
social media4
web si4
display none4
params tagid4
bidder gumgum4
ix params4
gumgum params4
bidder ix4
215626 bidder4
placementid 2156264
params inslot4
rhythmone params4
bidder rhythmone4
zxpvawmuy29t bidder4
tagid zxpvawmuy29t4
amx params4
4px solid4
importantcolor textcolorimportantez-cookie-dialog-wrapper4
bidder amx4
10px 20px4
cursor pointer4
para el3
ez-cookie-dialog ez-cookie-option3
display flex3
persnliche informationen3
comporta o3
20px importanttext-decoration3
pointer importantbackground3
tipi di3
solid transparent3
informacin personal3
sitios web3
informazioni che3
il link3
di cookie3
n n3
importantposition relative3
ez-cookie-dialog h23
ez-cookie-dialog p3
onze partners3
ez-cookie-dialog button3
zijn voor3
persoonlijke informatie3
soorten cookies3
nai partnerji3
o varstvu3
vrste pikotkov3
vra partners3
informazioni personali3
genom att3
cookies som3
av cookies3
typer av3
nai partneri3
il consenso3
dei dati3
trattamento dei3
questo sito3
siti web3
ez-cookie-dialog select-wrapper3
te maken3
constitutional classics3
die von3
function bid3
bidheight vasttimeout3
height bidheight3
bidwidth height3
width bidwidth3
configobj width3
settimeoutvar configobj3
try settimeoutvar3
null try3
bidvastxml null3
undefined bidvastxml3
bidvastxml undefined3
if bidvastxml3
bid if3
render function3
5000 maxallowedvasttagredirects3
goezodncomdetroitchicagospringfieldjscbdetroitchicagospringfieldjs render3
url goezodncomdetroitchicagospringfieldjscbdetroitchicagospringfieldjs3
renderer url3
250 renderer3
video contextoutstream3
mediatypes video3
10036575 bidder3
placementid 100365753
districtm params3
bidder districtm3
false true3
uspstring n3
false function3
vasttimeout 50003
maxallowedvasttagredirects 33
um die3
rendering backuponly3
les sites3
le lien3
des informations3
our partners3
contain personal3
personal information3
targetinguuid 2173283
217328 targetinguuid3
siteid 2173283
unruly params3
bidder unruly3
true bids3
backuponly true3
e consolelogeconsolelogerror3
3 allowvpaid3
catch e3
3000 catch3
configobj 30003
bidadunitcode configobj3
ezoicoutstreamplayerbid bidadunitcode3
adtext ezoicoutstreamplayerbid3
true adtext3
mute true3
false mute3
preload false3
true preload3
autoplay true3
true autoplay3
allowvpaid true3
ow oh3
cookies85
ez-cookie-dialog57
importantez-cookie-dialog-wrapper39
var32
die31
web31
params28
fr28
bidder28
que26
website26
se25
site24
true23
les22
di21
te21
o21
e21
att21
cookie20
za20
som19
your19
des17
none17
il16
le16
016
pour16
constitutional16
u16
if15
our15
adj114
information14
y14
we14
false14
et14
su14
da14
och14
per14
you14
adj214
el13
un13
av13
om13
law13
10px12
para12
may12
ez-cookie-dialog-wrapper12
s12
ki12
function11
che11
sitio11
van11
link11
display11
p11
kan11
los10
strani10
importantcolor10
partners10
dei10
sito10
code10
uw10
zu10
return9
19
websites9
u00269
n9
12px9
constitution9
29
podatke9
du9
si9
na9
mediatypes8
von8
solid8
placementid8
informacin8
bids8
ez-cookie-table8
je8
uspstring8
informazioni8
con8
width8
importantfont-size8
serif7
domainconstitutionorg7
path7
37
personal7
arial7
documentwrite7
siteid7
informatie7
webbplats7
partner7
pikotki7
nai7
can7
do7
med7
so7
voor7
5px7
data7
koje7
onze7
votre7
bidcpm7
functionbidcpm7
bidcpmadjustment7
zijn7
20px7
use6
vous6
gebruikt6
ou6
notre6
46
den6
56
del6
ali6
pikotkov6
met6
expiresfri6
sie6
op6
bidvastxml6
r6
configobj6
not6
1px6
web-mjesta6
koji6
us6
importanttext-decoration6
anvnder6
ihre6
importantfont-family6
rights6
auto6
ili6
null6
version6
privacy6
um5
nos5
spletne5
qui5
lahko5
page5
government5
deze5
datos5
65
16px5
kolaie5
partnerji5
sur5
har5
they5
sont5
vra5
dans5
textcolorimportantez-cookie-dialog-wrapper5
verwendet5
donnes5
size5
consent5
informations5
types5
principles5
een5
ow5
importantmargin5
importantposition5
undefined5
informationen5
importantwidth5
v5
media5
din5
importantbackground5
vrste5
75
video5
werden5
kolaii5
home5
banner5
amx5
success5
door5
all5
their5
partneri4
vr4
vae4
z4
podataka4
questo4
dessa4
sitios4
nostri4
genom4
son4
till4
spletni4
consenso4
siti4
momento4
nuestros4
cui4
consentimiento4
uporabljamo4
webbplatsen4
come4
dati4
web-mjesto4
eller4
socios4
oder4
gegevens4
vi4
remember4
have4
search4
importantpadding4
like4
84
margin4
importantline-height4
also4
tagid4
zxpvawmuy29t4
rhythmone4
94
ix4
inslot4
ezfadposition4
4px4
104
pointer4
education4
library4
flex4
process4
public4
state4
cursor4
interest4
new4
used4
importantmargin-top4
any4
private4
property4
height4
gumgum4
nous4
partenaires4
kunnen4
persoonlijke4
consentement4
services4
moment4
sites4
social4
0628164
als4
ce4
wilt4
aan4
worden4
auf4
verwenden4
toestemming4
sind4
andere4
border3
naih3
ez-cookie-option3
varstvu3
gebruik3
importantdisplay3
ons3
kot3
spletnih3
transparent3
osebne3
omogoajo3
maken3
button3
hebben3
hjlper3
importantheight3
dat3
select-wrapper3
input3
block3
relative3
content-box3
inte3
podatkov3
denna3
soorten3
utan3
personlig3
webbplatser3
lnken3
typer3
left3
frn3
samtycke3
h23
belang3
nastavitve3
navigation3
elite3
mute3
bid3
try3
settimeoutvar3
bidwidth3
bidheight3
vasttimeout3
113
maxallowedvasttagredirects3
allowvpaid3
autoplay3
preload3
adtext3
goezodncomdetroitchicagospringfieldjscbdetroitchicagospringfieldjs3
ezoicoutstreamplayerbid3
bidadunitcode3
123
catch3
consolelogeconsolelogerror3
rendering3
backuponly3
unruly3
targetinguuid3
133
oh3
func3
render3
url3
necessary3
please3
basic3
classics3
due3
constitutions3
reform3
provide3
applicable3
protections3
without3
response3
states3
content3
dont3
renderer3
share3
doesnt3
make3
no3
only3
password3
number3
else3
districtm3
143
div-gpt-ad-constitutionorg-large-mobile-banner-1-03
contextoutstream3
settings3
contain3
osobne3
memorizzare3
configuracin3
nuestra3
las3
necesarias3
este3
como3
comporta3
parte3
possono3
loro3
tipi3
personali3
lista3
visualizzare3
nostra3
sulla3
sono3
gli3
trattamento3
informacije3
nae3
mogu3
kolaia3
trenutku3
postavke3
proveedores3
tipos3
cookiescookiedetailslinkcookie3
diese3
utilisons3
avec3
peuvent3
plus3
politique3
confidentialit3
fournisseurs3
tout3
lien3
ncessaires3
ne3
marketing3
es3
pueden3
einige3
knnen3
wir3
persnliche3
speichern3
dieser3
wie3
der3
daten3
unserer3
interesse3
utiliza3
helfen3

Who hosts Constitution.org?

Constitution.org Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:nginx/1.16.0

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%

HTTP Header Analysis for Constitution.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: max-age=0, must-revalidate, no-cache, no-store
Content-Encoding: gzip
Content-Type: text/html; charset=UTF-8
Date: Fri, 21 May 2021 05:58:14 GMT
Display: pub_site_sol
Expires: Thu, 20 May 2021 05:58:14 GMT
Link:; rel="https://api.w.org/", ; rel="alternate"; type="application/json", ; rel=shortlink
Pagespeed: off
Response: 200
Server: nginx/1.16.0
Vary: Accept-Encoding,User-Agent
X-Ezoic-Cdn: Hit ds;mm;cd6ccae27cd24349bb2d4a2595e989fd;2-2228-7;97092101-f005-428d-49c8-82e21efb7f39
X-Middleton-Display: pub_site_sol
X-Middleton-Response: 200
X-Powered-By: PHP/7.4.18, PleskLin
X-Sol: pub_site
Transfer-Encoding: chunked

Constitution.org Domain Nameserver Information

HostIP AddressCountry
ns-185.awsdns-23.com 205.251.192.185
ns-1471.awsdns-55.org 205.251.197.191


Need to find out who hosts Constitution.org?


Domain Registration (WhoIs) information for Constitution.org

 Domain Name: CONSTITUTION.ORG
Registry Domain ID: D2800891-LROR
Registrar WHOIS Server: whois-service.virtualcloud.co
Registrar URL: sav.com
Updated Date: 2021-01-22T11:07:43Z
Creation Date: 1996-02-06T05:00:00Z
Registry Expiry Date: 2030-02-07T05:00:00Z
Registrar Registration Expiration Date:
Registrar: Sav.com, LLC
Registrar IANA ID: 609
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8885808790
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Privacy Protect, LLC (PrivacyProtect.org)
Registrant State/Province: MA
Registrant Country: US
Name Server: NS-1471.AWSDNS-55.ORG
Name Server: NS-185.AWSDNS-23.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2021-04-18T16:13:42Z

Websites with Similar Names

Const-anta.ru
Сувенирная продукция с логотипом оптом, рекламные бизнес сувениры от РПК Константа
Const-art.ru
сайт живописца Константина Сиденина. живопись, графика, арт-тексты.
Const-carrer.com
404 Error - Not Found
Const-double.xyz
const-double.xyz -&nbspconst double Resources and Information.
Const-ent.com
Const-ent Construction
Const-foto.ru
Фотоцентр КОНСТАНТА: печать фото, полиграфия
Const-japan.com
Const Japan – Admiration is a very short-lived passion that immediately decays upon growing familiar with its object, unless it be still fed with fresh discoveries.
Const-kratos.com
Error 404 (Not Found)!!1

Recently Updated Websites

Iprogression.xyz (1 second ago.)Huohu8352.com (4 seconds ago.)Slc-editions.com (6 seconds ago.)Lahoriink.com (7 seconds ago.)Rosenhead.info (7 seconds ago.)Raindropsonroses.love (7 seconds ago.)Whywaitangi.com (8 seconds ago.)Bahrainhero.com (8 seconds ago.)Jwdemile.com (9 seconds ago.)Holmesimprovements.com (9 seconds ago.)Bamboofitnessworld.com (9 seconds ago.)Elizoebethlunsford.com (11 seconds ago.)Faethsfowlplay.com (11 seconds ago.)Thinairfamily.com (11 seconds ago.)Jerrysfloorstore.com (11 seconds ago.)Pe.school (12 seconds ago.)Hxfbtx.com (12 seconds ago.)Theclassicmanbrand.com (13 seconds ago.)Maxserie.tv (13 seconds ago.)Ds56.ru (13 seconds ago.)Tourismtown.com (14 seconds ago.)Graffitiunique2020.com (14 seconds ago.)Plainpm.com (14 seconds ago.)Championbrieftowitnesstoday.info (15 seconds ago.)Guatevet.com (15 seconds ago.)Everybodyownit.biz (17 seconds ago.)Fhaloanamarillotexas.com (17 seconds ago.)Wykstra.com (17 seconds ago.)Get-purpose.com (18 seconds ago.)Airvisionsolution.com (18 seconds ago.)

Recently Searched Keywords

spark kindness bear (1 second ago.)20200 comments speco (2 seconds ago.)rajoitetun radiopuhelimenhoitajan (3 seconds ago.)noras (5 seconds ago.)foodie pro theme (7 seconds ago.)seilnacht lichtenfels (7 seconds ago.)akıllı trafik (9 seconds ago.)project guru akurdi (10 seconds ago.)bean curd (11 seconds ago.)kada je (12 seconds ago.)relatedsearchnumber 5verticalspacing 2pxcolorattribution (12 seconds ago.)bijoux (14 seconds ago.)states here (16 seconds ago.)rgba0001 (16 seconds ago.)sztuka (18 seconds ago.)카카오 배틀그라운드 사양 (18 seconds ago.)samount (19 seconds ago.)one get (20 seconds ago.)how to write a enterprise alternative proposal (21 seconds ago.)margin-right 12px (21 seconds ago.)photography courses (23 seconds ago.)supprecentes.com (24 seconds ago.)soma temple north carolina (25 seconds ago.)out gates (27 seconds ago.)customs and border (28 seconds ago.)no questions (30 seconds ago.)couple goals mood twitter (33 seconds ago.)gelitirme programlar (34 seconds ago.)отчет о результатах самообследования (34 seconds ago.)jquery langpack (35 seconds ago.)