Contentfeed.net  |  Erfolgreiches Affiliate Marketing bei affilinet - affilinet
Low trust score  | 
affilinet ist eines der f├╝hrenden Affiliate Netzwerke und Performance Marketing Anbieter in Europa - Starten Sie Ihr Partnerprogramm oder werden Sie Publisher!




Contentfeed.net Website Information

Website Ranks & Scores for Contentfeed.net

Statvoo Rank Statvoo Rank:F
Alexa Rank Alexa Rank:206,211
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:30%
DMOZ DMOZ Listing:No

Domain Information for Contentfeed.net

Domain Registrar: UNITED-DOMAINS AG
Registration Date:2004-11-04  1 decade 4 years 6 months ago
Last Modified:2015-06-17  3 years 10 months 3 weeks ago
Expiration Date:2015-11-04  3 years 6 months 1 week ago

Whois information for contentfeed.net

Full Whois Lookup for Contentfeed.net Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Contentfeed.net. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: CONTENTFEED.NET
Registry Domain ID: 134315812_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.udag.net
Registrar URL: http://www.united-domains.de
Updated Date: 2016-11-05T07:35:23Z
Creation Date: 2004-11-04T14:04:09Z
Registry Expiry Date: 2017-11-04T14:04:09Z
Registrar: United-Domains AG
Registrar IANA ID: 1408
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +49.8151368670
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.AFFILI-NS.DE
Name Server: NS2.AFFILI-NS.DE
Name Server: NS4.AFFILI-NS.DE
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-14T21:29:44Z

Who hosts Contentfeed.net?

Contentfeed.net is hosted by VeriSign Global Registry Services in Germany.
Contentfeed.net has an IP Address of 46.18.189.35 and a hostname of 46.18.189.35 and runs Microsoft-IIS/8.5 web server.



Contentfeed.net Web Server Information

Hosted IP Address:46.18.189.35
Hosted Hostname:46.18.189.35
Service Provider:VeriSign Global Registry Services
Hosted Country:GermanyDE
Location Latitude:51
Location Longitude:9
Webserver Software:Microsoft-IIS/8.5

HTTP Header Analysis for Contentfeed.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache, must-revalidate
Pragma: no-cache
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: Accept-Encoding
Server: Microsoft-IIS/8.5
X-Frame-Options: SAMEORIGIN
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Wed, 12 Aug 2015 03:45:44 GMT


Need to find out who hosts Contentfeed.net?

Contentfeed.net Free SEO Report

Website Inpage Analysis for Contentfeed.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Contentfeed.net

skmstopticksicherheit und transparenzokt 16affilinet aufhabenzoneuniqueidaufsearch engineserviceifwebservices productlsungenoderqualittbei affilinetcashback order import16affilinet auf twitterassisteinestransparenzcommunities searchmediablogdurchaffiliatemarketing9geldwerdenjulpartnerprogramme bertoolbarcommercejun 17affilinetmatch master1starten17affilinet auf facebookschnezurgutscheintoolbesondersgehteinals09media publishermai 17affilinetknowledgeberinfosmobile publisher adsiestehtmasterif i nullmit demaug 17affilinet aufauf twitterimnindexsie sicheinenvar ielemgetelementsbytagnameimgindex ifskmstyleinfoneweideidsubstring0 eidlastindexofsubmenusowietravelregistrierenmobile advertisermit einemvon unsverdienenuntersttzengezieltenprogrammmobile advertiser sdkpartnerprogramme lead16affilinet aufpreisvergleichsseiten portalealle infosawin schlieenzumdeveloper17affilinet auf facebookdmexcosearchihrerfacebookschneelsekundenimporteuchzum lieblingsnetzwerkvar ielemgetelementsbytagnameimgindexallenetzwerkdesangebotefindet ihrpartnerprogrammelieblingsnetzwerkkunden zucookiessdkdienew affilinetonlinevon affilinetpublisher preisvergleichsseiten portalevorhanden11zusammenwiederjaneinemengine marketingfunctionchoiceunsereminfosaffilinet17affilinet aufmachtinternationalb2bfirefoxdiesesie mchtenlead generationwerbungielemgetelementsbytagnameimgindex ifnbspperformance marketing16affilinet8feedsauf twitter newdirektmai 17affilinet aufdie richtigenpartnerstoriesjan 17affilinet aufdabeifr advertiserbranchenesactualeineteilokt 16affilinetfacebookmrzseiteihnenproduktejul 17affilinetvarwordpresswidthaug 17affilinetportaleaugthemenwebseiten gutscheinportalesicherheitbrowserwieeidlastindexofsubmenuamp communitiesperformance adsorder importelse ifmarketingdeinerimport toolcommunities search enginejul 17affilinet aufoktbietetreportingheadlinewebseitepreisvergleichsseiten portale ampdas trackingtwitter new affilinetunstwitteranmeldungtools17affilinetber cookiesproduct feedspartnerprogramme lead generationtwitter newwerbemittelgutscheinportalebei der120wir sindawinadvertiserads successaffilinet performanceauf facebookdmexcofrschlieen sich6mrz 17affilinetproduktdaten4themenwebseitenjan 17affilinetmaitwitter affilinetundefined returnbeivonschlieenvergtungmarketing partnerprogramme leadistundefinedpartnerprogramme ber affilinettracking3tools affilinet assistjungeht esihreuntersttzen siewebservicesneuraumpublisher preisvergleichsseitenfr publisheraufgepasst5financeknowledge zonepxwireideidsubstring0vertrauenjetztihrauf twitter affilinetmanagementadvertisingadvertiser sdkaccountactual submenu0 ifpreisvergleichsseitenhierknntdmexcomedia publisher preisvergleichsseitencashback orderperformance ads successsind2017 affilinetad sdkconsentknnenad7elemattributesstylevaluesubmenuportale ampunternehmenmatchproductdemumleftimagefacebookdmexcodescriptionnatrlichnewmobilepayjun 17affilinet aufaffilinet istgroeaffiliateperformancemobile commerceaffilinet assistauf facebookihrenrichtigen partnerwirdplattform2dasfr dieadsaffiliatenetzwerkagenturen17affilinet auf twitterengineleaderreichenvon derpublisher admarketing partnerprogrammeunsereber affilinetauf facebookschnesuccess storiespay persichampaffiliatenetzwerkeimagesourcerightimagesuccessexklusivdefaultstylevergleichsrechnerawin schlieen sichpermobile publisheraffilinet mobilegeld verdienendenif imagesourceunsererausads success storiesnullpublisheroverstylemitrichtigenderstarten siewizardorder import toolmchtenielemgetelementsbytagnameimgindexdienstleistungencashbackwichtigsten10nutzerexklusiv produktdaten vorhandenreturnorderexklusiv produktdatenaffiliate marketinggenerationwebservices product feedssie ihresearch engine marketingfindetaffilinetdasszuportale amp communitiesmrz 17affilinet aufvergtung reportingproduktdaten vorhandenpublisher ad sdkinternetperformance marketing partnerprogrammeamp communities searchtools affilinetindex ifauchseittoolnurcommunities

Longtail Keyword Density for Contentfeed.net

KeywordsOccurences
17affilinet auf twitter10
16affilinet auf twitter10
aug 17affilinet auf8
auf twitter new7
okt 16affilinet auf7
twitter new affilinet7
var ielemgetelementsbytagnameimgindex if6
jun 17affilinet auf6
if i null6
jul 17affilinet auf5
sicherheit und transparenz5
order import tool5
cashback order import5
partnerprogramme lead generation4
jan 17affilinet auf4
auf twitter affilinet4
mrz 17affilinet auf4
mai 17affilinet auf4
marketing partnerprogramme lead4
performance ads success4
performance marketing partnerprogramme4
webservices product feeds4
mobile publisher ad4
tools affilinet assist4
ads success stories4
publisher preisvergleichsseiten portale3
media publisher preisvergleichsseiten3
exklusiv produktdaten vorhanden3
preisvergleichsseiten portale amp3
publisher ad sdk3
communities search engine3
awin schlieen sich3
partnerprogramme ber affilinet3
mobile advertiser sdk3
17affilinet auf facebookschne3
17affilinet auf facebookdmexco3
amp communities search3
search engine marketing3
portale amp communities3
17affilinet auf35
auf twitter20
aug 17affilinet13
performance marketing10
16affilinet auf10
jun 17affilinet10
affiliate marketing9
new affilinet7
twitter new7
geld verdienen7
okt 16affilinet7
order import6
jul 17affilinet6
index if6
ielemgetelementsbytagnameimgindex if6
var ielemgetelementsbytagnameimgindex6
fr publisher5
bei der5
performance ads5
ad sdk5
fr die5
bei affilinet5
import tool5
cashback order5
mobile publisher5
lead generation4
affilinet performance4
partnerprogramme lead4
sie sich4
jan 17affilinet4
mobile advertiser4
marketing partnerprogramme4
twitter affilinet4
produktdaten vorhanden4
publisher ad4
mrz 17affilinet4
tools affilinet4
product feeds4
webservices product4
vergtung reporting4
mai 17affilinet4
ads success4
sie mchten4
affilinet assist4
mobile commerce4
success stories4
zum lieblingsnetzwerk3
affilinet mobile3
findet ihr3
auf facebook3
von uns3
exklusiv produktdaten3
pay per3
richtigen partner3
das tracking3
starten sie3
geht es3
kunden zu3
mit einem3
untersttzen sie3
mit dem3
alle infos3
sie ihre3
amp communities3
portale amp3
preisvergleichsseiten portale3
communities search3
search engine3
fr advertiser3
engine marketing3
publisher preisvergleichsseiten3
media publisher3
0 if3
eideidsubstring0 eidlastindexof-submenu3
if imagesource3
else if3
themenwebseiten gutschein-portale3
undefined return3
match master3
advertiser sdk3
von der3
auf facebookschne3
auf facebookdmexco3
2017 affilinet3
von affilinet3
affilinet ist3
schlieen sich3
awin schlieen3
ber affilinet3
partnerprogramme ber3
knowledge zone3
ber cookies3
die richtigen3
actual submenu3
wir sind3
auf68
affilinet67
die46
17affilinet45
fr42
publisher38
der37
if37
sie31
marketing26
wir26
mit22
advertiser22
twitter20
var20
von20
zu19
performance18
eine18
mobile18
bei18
im18
das16
affiliate15
ein14
es14
sich13
aug13
null13
ber13
ist13
vergtung12
function12
ihr11
jetzt11
uns11
unsere10
partnerprogramme10
jun10
online10
tracking10
else10
16affilinet10
sind9
09
dabei9
den9
new9
zum9
partner9
sdk9
dem8
werbemittel8
index8
order8
kunden8
alle8
management8
als8
produktdaten8
des8
werden8
verdienen8
geld8
hier7
einem7
return7
blog7
sicherheit7
amp7
ihre7
wieder7
okt7
dmexco6
16
unserem6
jul6
knnen6
oder6
cookies6
richtigen6
lead6
ad6
import6
um6
exklusiv6
webseite6
durch6
aus6
plattform6
account6
mchten6
elemattributesstylevalue6
ielemgetelementsbytagnameimgindex6
cashback6
26
auch6
eines5
wordpress5
untersttzen5
affiliate-netzwerk5
vergleichsrechner5
diese5
transparenz5
tools5
branchen5
35
wie5
geht5
defaultstyle5
euch5
ads5
registrieren5
werbung5
mrz5
service5
tool5
zur5
mai5
jan4
44
submenu4
haben4
overstyle4
vorhanden4
54
64
internet4
wird4
74
natrlich4
uniqueid4
skmstoptick4
schlieen4
unternehmen4
success4
steht4
ihrer4
84
ihnen4
finance4
94
qualitt4
stories4
travel4
toolbar4
unserer4
per4
firefox4
infos4
b2b4
commerce4
generation4
reporting4
feeds4
assist4
webservices4
gutschein-tool4
product4
wichtigsten3
affiliatemarketing3
teil3
093
vertrauen3
bietet3
einen3
pay3
nur3
netzwerk3
affiliate-netzwerke3
sowie3
skmstyleinfonew3
nbsp3
starten3
angebote3
dass3
produkte3
besonders3
advertising3
seite3
groe3
description3
headline3
dienstleistungen3
ihren3
gezielten3
preisvergleichsseiten3
portale3
media3
gutschein-portale3
themenwebseiten3
communities3
search3
match3
master3
programm3
anmeldung3
engine3
wizard3
consent3
103
eideidsubstring03
actual3
px3
width3
eidlastindexof-submenu3
leftimage3
undefined3
browser3
rightimage3
imagesource3
neuraum3
agenturen3
knnt3
seit3
facebook3
findet3
113
nutzer3
macht3
direkt3
zusammen3
deiner3
lieblingsnetzwerk3
aufgepasst3
n3
developer3
erreichen3
zone3
knowledge3
international3
lsungen3
infosaffilinet3
facebookdmexco3
facebookschne3
choice3
awin3
123

What are the nameservers for contentfeed.net?

Contentfeed.net Domain Nameserver Information

HostIP AddressCountry
ns1.affili-ns.de 46.18.188.38Germany Germany
ns2.affili-ns.de 212.172.59.76Germany Germany
ns4.affili-ns.de 46.18.186.38Germany Germany

Contentfeed.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Contentfeed.net is a scam?