Contentmanufaktur.net  |  SEO-Agentur in München - Beratung, Content, Seminare | CONTENTmanufaktur GmbH
Low trust score  | 
SEO, Content und Seminare: Die CONTENTmanufaktur GmbH berät Qualitätswebseiten und liefert hochwertigen, einzigartigen Content.

Contentmanufaktur.net Website Information

Contentmanufaktur.net has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 565,866, a Majestic Rank of 0, a Domain Authority of 40% and is not listed in DMOZ.

Contentmanufaktur.net is hosted by domainfactory GmbH in Bayern, Ismaning, Germany, 85737.
Contentmanufaktur.net has an IP Address of 134.119.31.54 and a hostname of 134.119.31.54 and runs Apache/2.4.10 web server.

The domain contentmanufaktur.net was registered 1 decade 1 year 2 months ago by , it was last modified 4 years 2 months 3 weeks ago and currently is set to expire 3 years 2 months 2 weeks ago.


Whois information for contentmanufaktur.net

Full Whois Lookup for Contentmanufaktur.net Whois Lookup

Domain Name: CONTENTMANUFAKTUR.NET
Registry Domain ID: 1460803718_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.meshdigital.com
Registrar URL: http://www.meshdigital.com
Updated Date: 2017-08-22T06:40:58Z
Creation Date: 2008-04-29T15:08:18Z
Registry Expiry Date: 2018-04-29T15:08:18Z
Registrar: Mesh Digital Limited
Registrar IANA ID: 1390
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS.NAMESPACE4YOU.DE
Name Server: NS2.NAMESPACE4YOU.DE
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-10-15T21:31:46Z

Who hosts Contentmanufaktur.net?

Contentmanufaktur.net Web Server Information

Hosted IP Address:134.119.31.54
Hosted Hostname:134.119.31.54
Service Provider:domainfactory GmbH
Hosted Country:GermanyDE
Location Latitude:48.2333
Location Longitude:11.6833
Webserver Software:Apache/2.4.10

HTTP Header Analysis for Contentmanufaktur.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 26 May 2015 12:41:35 GMT
Server: Apache/2.4.10
X-Powered-By: PHP/5.2.17
X-Pingback: https://www.contentmanufaktur.net/xmlrpc.php
Link:; rel=shortlink
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 6720
Connection: close
Content-Type: text/html; charset=UTF-8


Need to find out who hosts Contentmanufaktur.net?

Contentmanufaktur.net Free SEO Report

Website Inpage Analysis for Contentmanufaktur.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Contentmanufaktur.net

ihreihrwir ihnenzumarbeitennbspwirvielinhaltendamitkeinewerdenzuoderfrdenesgooglecontentmanufakturdassnurmarketingmehrwebseitenihrercontenthelfencontent marketingderliefernlieben0auchbestennbsp nbspihrengerneihnenbieteninhalthabenunskonzeptenbsp nbsp nbspnichtfalsemitmnchendie bestensindkundenbei googleerreichenmachendasbeisieaufvonistdemauswenndieunsere

Longtail Keyword Density for Contentmanufaktur.net

KeywordsOccurences
nbsp nbsp nbsp6
nbsp nbsp10
wir ihnen5
content marketing4
die besten3
bei google3
wir29
sie26
mit21
die19
nbsp17
fr12
ihnen12
content10
ihre9
marketing8
den8
der8
auch8
mehr7
das7
bieten7
auf6
unsere6
zu6
ist6
bei6
nur6
wenn6
haben5
kunden5
besten5
google5
machen5
uns4
arbeiten4
oder4
dass4
nicht4
dem4
04
von4
helfen4
werden4
sind3
inhalt3
viel3
zum3
lieben3
inhalten3
konzepte3
ihren3
ihr3
liefern3
erreichen3
keine3
mnchen3
aus3
es3
damit3
webseiten3
ihrer3
contentmanufaktur3
gerne3
false3

What are the nameservers for contentmanufaktur.net?

Contentmanufaktur.net Domain Nameserver Information

HostIP AddressCountry
ns.namespace4you.com 80.67.16.124Germany Germany
ns2.namespace4you.com 193.223.77.3Germany Germany

Contentmanufaktur.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Contentmanufaktur.net is a scam?